SecReT6
Protein ID: 526457323
SecReT6 ID833
T6SS typei3
Gene symbolhcp1
Locus tagBDL_6062
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3186354..3186839 [-]
Productprotein hcp1
NoteTssD
UniProt IDS5P4J8
KEGG IDbpse:BDL_6062
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.40E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|526457323|ref|YP_008329825.1| protein hcp1 [Burkholderia pseudomallei MSHR305]
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEHAIDRASPNLM
KYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTTSFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3186839-3186354 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGCGCAGGATATTTTTCTGAAGATCGACGGCATCAACGGTGAATCCCTCGACGACAGCCACAAGGACG
AGATCGAAGTCCTGAACTGGAACTGGGAGATTCAGCAGGAATCGACGATGCACACGGGCAGCGGCGGCGG
CGCCGGCAAGGCGAGCGTGAAGGATCTGACGTTCGAGCACGCGATCGACCGCGCGAGCCCCAACCTGATG
AAGTACGCGCTGACCGGCAAGCACGTCGATCAGGCGGTGCTCGTGATGCGCAAGGCGGGCGGCAATCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCATCACGCGCGTGCGGCCGTCGGGCAGCCGCGACGA
CACCGAGCGCAGCCGCGAGACGGTATCGCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGACGAGCTTCGACATCAAGGGCAACAAGGAAGCCTGA