SecReT6
Protein ID: 526457335
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4808
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1651142..1651636 [+]
Producthypothetical protein
NoteTssB
UniProt IDS5NKJ8
KEGG IDbpse:BDL_4808
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.60E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|526457335|ref|YP_008328585.1| hypothetical protein BDL_4808 [Burkholderia pseudomallei MSHR305]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLTLSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1651142-1651636 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGACAACGAACGGATCCGTCGCGCCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CGCAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCACGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GTTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA