SecReT6
Protein ID: 526457372
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4805
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1646460..1648313 [-]
Producthypothetical protein
NoteTssA
UniProt IDS5NDI5
KEGG IDbpse:BDL_4805
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 577..587
Protein Sequence: 617 a.a.     [Download]
>gi|526457372|ref|YP_008328582.1| hypothetical protein BDL_4805 [Burkholderia pseudomallei MSHR305]
MGMSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEV
ADEADVAEAAEAAEAAEAAETAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAAPSAGTDTNAN
ADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFQLRRVACWSSVCALPETDAENGRTR
IAAPSASIVGAAKNIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGADARREVETAVRAL
LARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSRSSLPLSPRPSPPERSSPMAGEPARAPGD
ACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHEVPEAFARGVI
EPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLST
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c1648313-1646460 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGGGATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCGAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCCGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGTGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGAGACGGCCGAGA
CGGCCGAGACGGCCGAGGCCGATGCGCACGGCTCGACGGGAGGGCCGGCCGCGGAAATCGCGATTGCCGC
CGCCGAACAGGCTTTGATTGATCCGGCCGGTCGAGCCGCGCCGAGCGCAGGCACGGATACGAACGCGAAC
GCAGACGCCGCCGGGCAACCGGCGCGGCTCGACGAAGCGGCCGGCCGCGAACGCGCGCTCGCCGATGCGC
TCGCGCAACTGCATTGCGTCGCGACGGCGTTCGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCAGCT
GCGCCGCGTTGCGTGCTGGTCGAGCGTGTGCGCGCTGCCGGAAACGGACGCGGAGAACGGAAGAACGCGG
ATCGCCGCGCCGAGCGCTTCGATCGTCGGCGCGGCGAAGAACATCGACGGGGATGGCGAGCCCGTGGCGG
CGGTGCGCTTCGCCGAAGCGCATGCGCAGGCGTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCG
CGCGCTCGCGCGCGCGGGGGGCGACGGCGCCGATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCGCTG
CTTGCGCGGCTGCCGGGCCTCGACGCGCTGACGTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGC
GCGCATGGCTCGGCGAGCTTGGCGCGCCTGTTGTGGCGGCGGATGCGGTGTCGCGGTCGTCTTTGCCGCT
TTCGCCGCGACCTTCGCCGCCTGAGCGATCGTCGCCGATGGCGGGCGAACCGGCGCGCGCGCCGGGCGAT
GCGTGCGGGGCGAGCGCCGACGATGCAGTGGACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATC
TCGCGCTCCACGCGATTCAGCATGCGATCGATCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCACGCGT
GCGGTTGTGCGAGCTTGCGCGCGACCATTGGCCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATC
GAACCGATTCGGCGGCACGATTTGCTCGCATGGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCT
ATGCGCTGCTGATTCGGCGCGATCGCGAATCGGCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGT
CGACGCGGCGCGGGCCATGCGTTTGTCGACGTGA