SecReT6
Protein ID: 526457373
SecReT6 ID831
T6SS typei3
Gene symbol-
Locus tagBDL_5558
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2572198..2574069 [-]
Producthypothetical protein
NoteTssF
UniProt IDS5P4P8
KEGG IDbpse:BDL_5558
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-217, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|526457373|ref|YP_008329321.1| hypothetical protein BDL_5558 [Burkholderia pseudomallei MSHR305]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARPAAAEQTACEFRTAHDLTLWP
LELAGASVTGAPAYLPRSATAARRDVRGALRIRLKARGGAGLAQLPIDRLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHALGAHALAHQGFDADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLAGEQRDDGQMRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPRPPLADAQSAW
RLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFAPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2574069-2572198 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAGCTCGCGTATCTGCGCGAGTTGGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCGTACGTCGA
GCGGCTGCTCGAAGGCTTCAGCTTTCTCACCGCGCGCGTGCAACTGAAGATGGACGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCGGTGTATCCGGGTTACGTCGCGCCGCTTCCGTCGATGGCGATCGTGC
AGTTCACGCCGATGATGAACGAAGGCAGCCTCGCGCAGGGCTACCGGCTGCCGGCGGGCACCGCGCTGCG
CGCGCGGCCCGCCGCGGCCGAACAGACCGCGTGCGAGTTTCGCACCGCGCACGATCTGACGCTGTGGCCG
CTGGAGCTCGCGGGCGCTTCGGTGACGGGCGCGCCCGCGTATCTGCCGCGTTCGGCGACGGCCGCGCGCC
GCGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGCGCGCGGCGGCGCGGGCCTCGCGCAACTGCCGAT
CGATCGGCTGATGTTCCACCTGGCGGGCCCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGG
CATACGATCGGCGTCGTCTGCCACGACGCGGCGCAGCCGCCGCGCTGGCTGCACGCGCTCGGCGCGCACG
CGCTCGCGCATCAGGGCTTCGACGCCGATCAGGCGCTGCTGCCCGACGAAGGCCGCAGCTTCCACGGTTA
CCGGCTGCTGCGCGAGTACTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAAGGATTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGATCGGCACGACGCGGCGCTCG
AGAACAGCGTCGATGCGCGGCACCTCGCGTTGAACTGCACGCCGGCCGTCAACCTGTTCGCGCGGCGCGC
GGACCGCATTCCGGTCCATCCGGGCGCGCGCGAGCATCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTACGCGGTGCGGCGGCTCGCGGGCGAGCAGCGCGACGACGGGCAGATGCGCGCGTTCCGGC
CGTTCCATGCGTCGTTCGCGGGCGACGGCGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
CCTCGTGTCCGCGCAGGCGCGCGCGAACGGTACGCGCACCGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGATAGCGCGTGCGCGCCGTATGACGAATCGATCCGCTATCTGTCCGTCGACACGCTGTGCACGA
ACCGCGATCTCGTCCTGCTGTTGCCGGCGGGCGACGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCATGATCCGCGGGCCGTCGCGGCCGCGCCCGCCGCTCGCCGACGCGCAGAGCGCGTGG
CGGCTCGTGAGCCATCTCGGGCTCGCGCGCCACACGCTGACCGATGTCGACGACGAAGAAGGCGCGCGCG
TGCTGCGCGAATTGCTCGGCCTGCACGCGGACCCGGCCGATGCGGCGATGCGCCGGCAGATCGACGGCGT
GCATCGTGTCGCGTTCGCGCCGGTGTTTCGCCGGCTGCCCGCCGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGACGTGACCGTCGACGATCATGCGTTCTCCGGCGACAGCCCCTATTTGCTCGGCGCGGTGC
TCGAGCAGTTTTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAATGGCCGGCGCGCGTCGGCAGGCGGCCCGCGATATGA