SecReT6
Protein ID: 526457389
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5934
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3027491..3028990 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5NK20
KEGG IDbpse:BDL_5934
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|526457389|ref|YP_008329697.1| hypothetical protein BDL_5934 [Burkholderia pseudomallei MSHR305]
MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVKTLAEQALANSVTLSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQQLESAWRGLHHLVTNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3027491-3028990 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGCTGCACGTGAATCTCAGGCGCGCTCCGCCGATGCACAGCTCGCTACGCACTCGGACTTCAATGCCC
TGCTGTCGCGCGAGTTCAAACCGAAGACCGAACAGGCGCGCGAGGCGGTGGAACATGCCGTCAAGACGCT
GGCCGAGCAGGCGCTCGCCAATTCTGTGACGTTGTCGGACGACGCTTACAAGAGCATCGAAGCGATCATC
GGCGAAATCGATCGAAAGCTGTCCGAGCAGATCAACCTGATTCTGCATCACGACGATTTCCAGCAGCTGG
AAAGCGCATGGCGCGGCCTGCATCATCTGGTGACGAATACCGAGACGGACGAGAAGCTCAAGATCCGCTT
CATGGACGTCTCCAAAGACGATCTGCGCCGTACGATGAAGCGATACAAAGGCGTGGCCTGGGACCAGAGC
CCGTTTTTCAAGCAGATCTACGAAGAGGAATACGGTCAGCTCGGCGGCGAGCCGTATGGATGCCTCGTGG
CCGACTACTACTTCGACCACACGCCGCCGGACGTCGATCTGCTTTCGTCGATCGGCAAGGTGGCGGCTGC
CGCGCACGCTCCGTTCATTACCGGCGCATCGCCTTCGGTACTCCAGATGGATTCCTGGCAAGAGCTGGCC
AATCCGCGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATATGCGCCCTGGAATTCGCTGCGCAATT
CCGAAGATGCCCGTTATATCGGTCTTGCGATGCCGCGCTTCCTCGCACGCTTGCCGTATGGAATCAGGAC
GAATCCCGTCGACGAATTCGATTTCGAGGAATCGACGGATGGGTCCGATCATCGCAAGTACGTGTGGGCG
AATGCCGCGTATGCGATGGCGGTCAACATCAATCGCTCGTTCAAGCATTACGGCTGGTGCACGCTGATTC
GCGGTGTGGAAAGCGGCGGCGTCGTCGAGAACCTGCCTTGCCATACGTTCCCGACGGACGACGGCGGCAT
CGACATGAAGTGTCCGACCGAAATCGCGATTTCCGATCGCCGCGAAGCGGAGCTCGCGAAGAACGGCTTC
ATTCCGCTGATCCATCGAAAGAACACCGACTACGCGGCATTCATCGGAGCGCAATCGCTGCAGAAGCCGG
CCGAGTACTACGACCCGGACGCCACCGCGAACGCGAACCTGTCCGCCCGCCTGCCGTACCTGTTCGCGTG
CTCGCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGGAGCGCGAAGAC
ATGCAGCAGTGGCTCAACGAATGGATCATGAACTATGTCGACGCCGACCCGGCGAACTCGTCGCAGGAGA
CCAAGGCGCGCCGTCCGCTGGCCGCGGCCGAAGTGGTTGTCGAAGACGTGGAAGGCAATCCGGGCTACTA
CCAGGCGAAGTTCTTCCTGCGTCCGCACTTCCAGCTGGAAGGGTTGACCGTGTCGCTGCGCCTCGTCGCG
AAGCTGCCCTCGGTCAAGGAAGCGGCGTAA