SecReT6
Protein ID: 526457404
SecReT6 ID833
T6SS typei3
Gene symbolclpV
Locus tagBDL_6065
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3189107..3192046 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDS5NK44
KEGG IDbpse:BDL_6065
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-38, Aligned region: 231..265
AAA_2 [PF07724], Evalue: 3.60E-38, Aligned region: 688..854
AAA [PF00004], Evalue: 4.90E-20, Aligned region: 233..364
AAA [PF00004], Evalue: 4.90E-20, Aligned region: 693..776
AAA_5 [PF07728], Evalue: 9.50E-14, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 9.50E-14, Aligned region: 692..810
ClpB_D2-small [PF10431], Evalue: 1.30E-13, Aligned region: 860..930
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 32..77
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 210..250
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 274..311
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 687..736
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 757..780
AAA_16 [PF13191], Evalue: 3.60E-08, Aligned region: 836..893
Sigma54_activat [PF00158], Evalue: 4.10E-07, Aligned region: 229..313
Sigma54_activat [PF00158], Evalue: 4.10E-07, Aligned region: 692..791
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 378..400
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 691..714
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 754..778
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 231..256
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 491..491
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 690..718
IstB_IS21 [PF01695], Evalue: 2.70E-05, Aligned region: 226..290
IstB_IS21 [PF01695], Evalue: 2.70E-05, Aligned region: 692..712
IstB_IS21 [PF01695], Evalue: 2.70E-05, Aligned region: 762..790
AAA_29 [PF13555], Evalue: 5.50E-05, Aligned region: 225..251
AAA_29 [PF13555], Evalue: 5.50E-05, Aligned region: 690..717
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 467..489
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 690..724
NACHT [PF05729], Evalue: 0.00014, Aligned region: 233..261
NACHT [PF05729], Evalue: 0.00014, Aligned region: 692..718
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 233..252
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 692..729
AAA_18 [PF13238], Evalue: 0.0002, Aligned region: 233..266
AAA_18 [PF13238], Evalue: 0.0002, Aligned region: 693..722
Zeta_toxin [PF06414], Evalue: 0.00023, Aligned region: 232..253
Zeta_toxin [PF06414], Evalue: 0.00023, Aligned region: 691..732
Clp_N [PF02861], Evalue: 0.0022, Aligned region: 28..74
Clp_N [PF02861], Evalue: 0.0022, Aligned region: 468..483
AAA_14 [PF13173], Evalue: 0.0025, Aligned region: 233..313
AAA_14 [PF13173], Evalue: 0.0025, Aligned region: 691..774
Protein Sequence: 979 a.a.     [Download]
>gi|526457404|ref|YP_008329828.1| type VI secretion ATPase, ClpV1 family [Burkholderia pseudomallei MSHR305]
MAISRQALFGKLGATLFRAIESATVFCKLRGNPYVELVHWLQQLLQQSDSDLHRIVRHAGIERDALDRDI
ARALAALPAGAGSISDFSHHVEAAIERAWVLATLRFGDRRIRGAWLVAALVDTPELRRVLLSISPAFARI
PHDDALDDVLPAWTAGSPEAADAPYDHADSAPASPGEPSGATRAAPNGSPLERYCTDLTARARDGDIDPV
IGRELEIRTMTDVLLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGDVPPKLADVRLMSVDVGALLAGAG
MKGEFESRLKGVLEAAAKSVAPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTIGATTWAEYK
RHIEKDPALTRRFQVLQVPEPEEPAAVHMVRGVARAFARHHRVTVRDEAIRAAVALSHRYIPSRHLPDKA
ISLLDTACARVALSQHAAPGELQHVRQRLLAARAERDLLEQEARIGLDAGQSLAAVRERIEALAAEEAAV
DARWKAQADAARALLAAREAALAECHRESCAETRAGSLSESRAESRTESRARSHIDSSAYAHSDVPAEMH
VGSHAGSRAATRPDTHAEAHAAPASPPPAADTPHAGAAPGLRELERALAAAQGDAPLVFPEVDEAIVAQI
VADWTGIPVGRMMTDEVAAVRALPATLEARVIGQPDALRQIGERVQTARAGLADPKKPLGVFLLAGPSGV
GKTETALALAEALYGGEQSLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEI
EKAHRDVHELFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGAELSASLCADASLAPDAAALRDALMPEL
LKVFPAAFLGRVSVVPYRPLEARALARIVRLHLDRVVARMAERHRIALAYDDAVVDYVVGRCLVQETGAR
LLIGFIEQHVLPRLSALWLDAFPSKAALARIDIGVADAAAPAARALVFRPGQASRAGPPNAPLTAVQAG
 
Nucleotide Sequence: 2940 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3192046-3189107 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGCGATCTCGCGTCAGGCGCTGTTCGGGAAACTCGGGGCTACGCTCTTCAGGGCGATCGAATCGGCCA
CGGTTTTCTGCAAGCTGCGCGGCAATCCGTACGTCGAGCTGGTGCACTGGCTGCAGCAGTTGTTGCAGCA
GTCCGACTCCGATCTGCACCGGATCGTGCGGCACGCCGGCATCGAGCGCGACGCGCTCGATCGCGACATC
GCGCGCGCGCTCGCCGCGCTGCCGGCCGGCGCGGGCTCGATCAGCGATTTTTCCCATCACGTCGAAGCCG
CGATCGAGCGCGCATGGGTGCTCGCGACGCTGCGCTTCGGCGACCGGCGCATCCGCGGCGCATGGCTCGT
CGCCGCGCTCGTCGATACGCCGGAACTGCGGCGCGTGCTGCTTTCCATTTCGCCGGCGTTCGCGAGGATT
CCTCACGACGACGCTCTCGACGACGTGCTGCCCGCGTGGACGGCCGGTTCGCCGGAAGCGGCGGACGCGC
CGTACGACCACGCCGATTCCGCGCCCGCTTCGCCGGGCGAGCCGTCCGGCGCGACGCGCGCCGCGCCGAA
CGGCTCGCCGCTCGAGCGATATTGCACGGACCTGACCGCGCGCGCGCGCGACGGCGACATCGACCCCGTC
ATCGGGCGCGAGCTCGAAATCCGCACGATGACTGACGTGCTGCTGCGGCGCAGGCAGAACAATCCGCTGC
TCACCGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAGGGCCTCGCGCTCGCGATCGCGAACGGCGA
CGTGCCGCCGAAGCTGGCCGACGTGCGCCTGATGAGCGTCGACGTGGGCGCGCTGCTGGCCGGCGCGGGC
ATGAAAGGCGAATTCGAATCGCGCCTGAAAGGCGTGCTCGAGGCCGCGGCGAAATCCGTCGCGCCCGTCA
TCCTGTTCGTCGACGAGATTCACACGCTGATCGGCGCGGGCGGACAGGCCGGCACGGGCGACGCGGCGAA
CCTGCTCAAGCCCGCGCTCGCGCGCGGCACGATCCGCACGATCGGCGCGACGACATGGGCGGAGTACAAG
CGGCACATCGAAAAGGATCCCGCATTGACCCGCCGCTTTCAGGTGCTGCAAGTGCCGGAGCCCGAAGAGC
CGGCCGCGGTGCACATGGTGCGGGGCGTCGCGCGAGCGTTCGCGCGGCACCACCGCGTGACGGTGCGCGA
CGAGGCGATCCGCGCCGCCGTCGCGCTGTCGCACCGCTACATTCCGTCGCGGCATCTGCCGGACAAGGCG
ATCAGCCTCCTCGACACCGCATGCGCGCGCGTCGCACTCTCGCAGCACGCCGCGCCCGGCGAACTGCAGC
ACGTACGCCAGCGCTTGCTCGCGGCGCGCGCCGAGCGCGATCTGCTCGAACAGGAGGCGCGCATCGGGCT
CGACGCCGGGCAATCGCTCGCGGCGGTGCGCGAACGCATCGAAGCGCTCGCGGCCGAGGAAGCGGCCGTC
GACGCGCGCTGGAAGGCGCAGGCCGACGCGGCGCGCGCGCTGCTCGCCGCGCGCGAGGCCGCGCTCGCGG
AATGTCACCGCGAGTCTTGCGCCGAAACGCGCGCCGGCTCGCTCTCCGAATCTCGTGCCGAATCTCGTAC
CGAATCGCGCGCCAGATCACACATCGACTCCAGCGCCTATGCTCACAGCGACGTCCCGGCCGAAATGCAC
GTCGGCTCGCACGCCGGCTCGCGCGCCGCAACGCGTCCGGACACGCACGCCGAAGCGCACGCCGCCCCCG
CCTCGCCCCCGCCCGCCGCCGATACGCCACACGCCGGCGCCGCCCCCGGGCTGCGCGAGCTCGAACGCGC
GCTCGCGGCGGCCCAGGGCGACGCACCGCTCGTGTTCCCGGAAGTCGACGAGGCGATCGTCGCGCAGATC
GTCGCGGATTGGACCGGCATTCCGGTCGGCCGCATGATGACCGACGAAGTCGCCGCCGTGCGCGCGCTGC
CCGCGACGCTCGAGGCGCGCGTGATCGGCCAGCCCGACGCGCTGCGGCAGATCGGCGAGCGCGTGCAGAC
CGCGCGCGCGGGCCTCGCCGATCCGAAGAAGCCGCTCGGCGTATTCCTGCTTGCGGGCCCGTCGGGCGTC
GGCAAGACCGAAACGGCGCTCGCGCTCGCCGAGGCGCTGTACGGCGGCGAACAGAGCCTGATCACGATCA
ACATGAGCGAGTACCAGGAAGCCCACACCGTGTCGGGCCTCAAGGGCGCGCCGCCCGGCTATGTCGGCTA
CGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGCGTCGTGCTGCTCGACGAGATC
GAGAAGGCGCACCGCGACGTGCACGAACTCTTCTTCCAGGTCTTCGACAAGGGCTACATGGAAGACGGCG
ACGGCCGCTACATCGATTTCCGCAACACGACGATCCTGCTCACGAGCAACGTCGGCGCGGAACTGAGCGC
GAGCCTGTGTGCCGACGCATCGCTCGCGCCCGATGCCGCCGCGCTGCGCGACGCGCTCATGCCCGAACTG
CTGAAGGTCTTCCCCGCCGCGTTCCTCGGGCGCGTGAGCGTCGTGCCGTACCGGCCGCTCGAAGCGCGCG
CGCTCGCGCGCATCGTGCGCCTGCATCTGGATCGCGTCGTCGCGCGCATGGCCGAGCGGCACCGCATCGC
GCTCGCGTACGACGACGCCGTCGTCGACTACGTCGTCGGGCGTTGCCTCGTGCAGGAAACCGGCGCGCGG
CTGCTGATCGGATTCATCGAGCAGCACGTGCTGCCTCGGCTGTCCGCGCTGTGGCTCGACGCGTTCCCGT
CGAAGGCGGCGCTCGCGCGCATCGACATCGGTGTGGCCGACGCGGCCGCGCCCGCGGCGCGCGCGCTCGT
CTTCCGGCCCGGCCAAGCAAGCCGGGCGGGGCCGCCGAACGCGCCGCTCACCGCCGTGCAGGCCGGCTAG