SecReT6
Protein ID: 526457553
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5936
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3029869..3030342 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDS5P565
KEGG IDbpse:BDL_5936
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.00E-37, Aligned region: 3..151
Protein Sequence: 157 a.a.     [Download]
>gi|526457553|ref|YP_008329699.1| type VI secretion lipofamily protein [Burkholderia pseudomallei MSHR305]
MVCASLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPVMVRLYELKSAGAFENADFFTLQSDSRKV
LGDDAIATDEFVMRPGDTRDIHRRADSAGTSVGVLVGYRELGKSVWRAVHKLRPAPEDAWYRAFTPRTKI
KLNVDVGQQTVTITELE
 
Nucleotide Sequence: 474 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3029869-3030342 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGTATGCGCATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAAACAGCCGATCTGATCGTGA
AGATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGCCCGTGATGGTGCGGCTGTA
CGAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACAGAGCGACAGCCGCAAGGTG
TTGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGACACCCGGGATATTCATCGGC
GTGCCGATTCCGCGGGGACGTCGGTCGGCGTGCTGGTCGGTTATCGAGAGCTCGGCAAATCGGTGTGGCG
GGCGGTCCATAAGCTGCGGCCGGCTCCGGAGGATGCATGGTACCGGGCATTCACGCCAAGGACGAAAATC
AAGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAATGA