SecReT6
Protein ID: 526457573
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4809
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1651633..1653159 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5P588
KEGG IDbpse:BDL_4809
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-187, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|526457573|ref|YP_008328586.1| hypothetical protein BDL_4809 [Burkholderia pseudomallei MSHR305]
MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPK
RPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTAL
FDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEER
VDGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKV
IQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHF
KYMGAFFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1651633-1653159 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAACCGCGACACGGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGC
CGGACGCGACGCCGCCCGAGTCCCCCGCCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAAGACGCATACCCGATCACGCGCCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGATCGACGCGATCCTCCATGACCCGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTT
TCTCGTCGATCGAACGGATTTCCGCGAGAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTG
TTCGACGACTTCGAGGATTCGCCCGACATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGT
ACGGCCAATTCGGCGGCCAGCCGATCGGCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGA
CGTCAAGCTGCTGCAGTACGTCGCGAGCACGTCGGCGATGGCGCACACGCCGTTCATCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGG
GGCCGCAATACGCGAAATGGAATGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCTTGCTGCGGCTGCCTTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGC
GTCGACGGCGGCGACGCGCATTTTCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGA
GCTTCGCCGACTATCGCTGGTGCGCGAACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCC
GCTCTACGCGTACGAATCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAGTTCGAGCTCGCCGAACAGGGCTTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCTGCCT
TTTTCTCCGCGAACTCCACGCAGAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCT
CAACTACCGGCTCAGCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTG
ATCCAGCGGGAAAACATCGGCTCGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCC
GCCAGTACGTCGTCGACATGGACAACCCGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCA
GATCGTCGTGTCGGACGTCGAGGGCGAACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTC
AAGTACATGGGCGCGTTCTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTAG