SecReT6
Protein ID: 526457575
SecReT6 ID831
T6SS typei3
Gene symbol-
Locus tagBDL_5555
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2565877..2568081 [-]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDS5NL93
KEGG IDbpse:BDL_5555
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 23..325
Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 581..641
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 510..525
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 530..547
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 646..664
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 715..727
Protein Sequence: 734 a.a.     [Download]
>gi|526457575|ref|YP_008329318.1| Rhs element Vgr family protein [Burkholderia pseudomallei MSHR305]
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGI
VARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDY
CVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDS
WLPAQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAE
HERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLP
YRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKG
AEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETH
GVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHA
EEIGSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTV
ESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2568081-2565877 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
GTGACCCGCGTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGG
AAGCGCTCGGGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGA
ACTGCTCGGCAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATC
GTCGCGCGCGCCGCGCTGGTCGGGCGGCGCGCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGT
GGCTGTGGCTCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAAATCGTGCA
GGACGTGCTCGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTAC
TGCGTGCAGTACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACT
ACTTCAAGCACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCC
GGGCTACGAGCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGC
TGGCTGCCCGCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCG
CGGATCTGTCCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCC
CGGCGGCTATCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAG
CACGAACGCGCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACT
GCCCGCGCGCCGACCAGAACCGCGAATACCTGATCGTGCGTTGCCAGTATCGGTTTCAGGAGAACGCGTA
CGCGACCGATAGCGGCAACGAGGCGGTCGTGCACGAATCTCAGACACTCGTGCAGCCTTCGAGCCTGCCG
TATCGCTCGCCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGA
AGGGCGAGGAAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCA
GAGCGACCAGAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTG
CAGATCCCGCGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGA
CGGGGCGCGTGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACACAAAGCGGGCT
GCTGTCGCGCTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGC
GCGGAGCAGCTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACTGAGCAGGACCACACGCTGTCGG
TGGGCCACGATCATTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAG
CGTCGGGCAGAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCAT
GGCGTCGCGGGAAACCGCACGCGGCAGGTCGGACAGAACGAAGCCGTGACGATCGGCGCGAATCGCGAGG
CGACGATCGGCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATTGGGCAGGGCAAGAC
GCTGAATGTCACTCAGCACTATCAGACGACTTCGAAAAGCATGAAGACCGCTGTCGCCGAACATCACGCC
GAGGAGATCGGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGG
TGAACGTTGGCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTC
GCTCGTTTGCGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATCGCGATCAACGGCGTCACGGTG
GAATCGAGCGCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACA
CGGTGGAAGGCACGATACTGAAACTGAACCCCTGA