SecReT6
Protein ID: 526457750
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5948
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3048694..3050574 [-]
Producthypothetical protein
NoteTssF
UniProt IDS5NLP2
KEGG IDbpse:BDL_5948
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|526457750|ref|YP_008329711.1| hypothetical protein BDL_5948 [Burkholderia pseudomallei MSHR305]
MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPYVERLIEAFCFMSARTQLKLEAEFPR
FTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDFSKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWP
IEIAGATLTAVPPDLPDLQRSLLPHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFEL
IHASSVASVVRAPGAARGEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQ
LNAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQTAFHLIPDRTR
PLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRTTSTNARKYGTRTPYVGTEV
YVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPSAPREPYATGE
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVY
GRGVRCELTVDESGFSGLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3050574-3048694 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGACCCGCAGTTTCTCGATCACTACAACCGCGAATTGACCTACATGCGGGAGTTGTCCGCGGAATTCG
CGGCGCAACACCCGAAGATCGCGCGCCGACTCGGCATGCAAGGCATCGAAGTGGCGGACCCGTACGTAGA
ACGGCTCATCGAGGCGTTCTGCTTCATGTCCGCGCGCACGCAACTCAAGCTCGAGGCCGAGTTCCCCCGC
TTCACGCAACGCCTGCTCGAAGTCGCCTATCCGAATTACGTCGCGCCGACGCCGTCGATGGCCGTCGCGC
GCCTGCGTCCAAGCCTGCGGGAAGGCGACTTCAGCAAGGGGTTCAAGGTTCCGCGTCACAGCATGCTGCG
CTCGTCGATCCCGCCCGGCGAGCAGACCGCATGCGAATTCCGCACCGGCCAGGACATCACGCTCTGGCCC
ATCGAGATCGCCGGCGCGACGCTGACCGCCGTGCCGCCCGATCTTCCGGATCTTCAGCGCAGCCTGCTGC
CGCACACGAAGCTGCGCGGCGCACTCCGGCTGCGCGTGCGCACCGTCGGCGAAATCAGGTTTTCGCAAAT
TACCGGGCTCGATCGCCTCTCGCTGTATATCGGCGGCGACGAACGCATCGCCTCCCATCTTTTCGAGCTG
ATTCACGCGAGCAGCGTCGCGTCGGTCGTGCGCGCGCCGGGCGCCGCGCGCGGCGAAGGCGCCGTCGTCG
CGAAGAATGCGGTCGACTTCGAAGGCCTGTCGCCCGATCAAAGCCTGTTGCCGCTCGTCTGGAATACGTT
CCACGGGCACAATCTGCTGCACGAATACTTCACCTGCCGTCAACGCTTCTATTTCTTCGCGCTCACGCAA
TTGAACGCCGGCTTGTCGCGCATCGACGGAAAGGAAGCCGAAATCGTGCTGTTGCTCGACCGCTTGCCCG
ACGAGCTCGTCACGCACGTCGAGGCCGCGCGCTTTCTGCTGTTTTGCGCCCCCATCGTCAATCTGTTCCC
GAAGCGGACCGACCGGGTGGAAATCAATCGCGCCCAAACGGCTTTCCACCTGATACCGGACCGCACCCGC
CCGCTCGATTACGAAGTATTCTCGGTGTCGCGCGTGTTCGGGCAAAAAGCCGAGACGTCGACGGAAGTCA
CGTTCAATCCGCTCTATCAGACGCTGCATAGCGACATCGGCAATTACGGCCGGTATTTCTCGATCCTGCG
CGAACCCAGAACGACATCGACCAACGCGCGTAAATATGGAACGCGCACGCCATACGTCGGAACGGAAGTC
TACGTGTCGCTCGTCGACCAGGCCGAAGCGCCGTACGCCGACGACATTCGTTACCTGTCCGTCGACGCAT
GGGTCACCAACCGCGATTTGCCCCGACTGATCCCGCGCAACGGCGTCAACGATCTGACGATGCAAGACTC
CGTGCCGATCGAGGGCGTGAGCCTCGTCCATCCGCCGAGCGCGCCGCGCGAGCCGTACGCGACCGGCGAA
ACCGCGTGGCGGCTGATTCGCCAGCTCAGCTTCAACTACATGCCGCTTGCCGAGCTCGACCACCGCGACG
GCGGGCAAGCACTGCGCAACATGCTGCGCCTCTTCGTCGGCACGAGCGAGCGCGAACAGGCCACGCAGAT
CGACAGCCTGGTCGGCGCGCGCACGGAGCCTGTCGTCCGCCGTCTGCCCGGCCACGGATTACTGGTTTAC
GGGCGCGGCGTCCGGTGCGAGCTGACCGTCGACGAAAGCGGCTTCTCCGGGTTGAGTCCATACCTGTTCG
GTCTCGTGCTCGAGCAATACCTCACGCGCCACGTCTCGATCAATGTGTTCACCGAGACGGAGCTTCGCTC
GATGCAACGCGGTCTCGTCACGCGCTGGAAACCGCGCATGGGCGGAAGGGGCGCGGTATGA