SecReT6
Protein ID: 526457756
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5947
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3047648..3048697 [-]
Producthypothetical protein
NoteTssG
UniProt IDS5NZK7
KEGG IDbpse:BDL_5947
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-98, Aligned region: 29..330
Protein Sequence: 349 a.a.     [Download]
>gi|526457756|ref|YP_008329710.1| hypothetical protein BDL_5947 [Burkholderia pseudomallei MSHR305]
MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAARDTRMPLPGTACLPKEEAFRIGQRP
SMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGPLPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALF
YRAWASSQATVSLDRAEHETFSFYIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHY
FGVPIAVDEYVFHWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHG
NDLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGMVFEPEKYCS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3048697-3047648 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGACGGCGCATCCGCCCGCCGCCCGGCCCATCGACGCCCACTCGCCCCTGCATCCGGACGCACTGCGGG
CATGGTTCGATCCGCAAGCGCCGTGGCGCGCCGGCTTTCTGAGCCTGTTGCGCGCAATCGCCGCACGCGA
CACGCGCATGCCCTTGCCCGGAACGGCGTGTCTGCCGAAGGAAGAGGCGTTTCGCATCGGACAACGGCCG
TCGATGGCCTTCGCGCCGCGCGAGATCGCATCGCTCGACGTGCAGCGCGGGCGTCTCGACATTCAGCTGT
TCGGCCTCGGCCTATGGGGGCCGCAGGGGCCGTTGCCGCTTCACATGACCGAGCTCGCGTACAACCGCGC
CGAGAGCTATCAGGATCATGCGATCGCGCATTTCTCCAATCTCTTTCACCATCGTGCGCTCGCGTTGTTC
TATCGTGCGTGGGCGTCGTCACAGGCGACCGTATCGCTCGATCGCGCCGAGCACGAAACGTTCTCGTTCT
ATATCGGCAGCCTGATGGGCACCGATCCCGAAGAAGCCGCGCGTACGCACCCGCCCACGCACGCGCGGTA
CGCCGCATGCGCGCATCTCGTGCGCGAGGCGCGCAATCCGGACGGCGTGGCCGCCACGCTGTCGCATTAC
TTCGGCGTGCCGATCGCCGTCGACGAATACGTCTTCCACTGGATCCGGATTGCGCCGCCGGAGCGTTGCC
TGCTCGGCGCGCGCGCCGCATCGACCGTCATGGGCGAGGGCGCGCTGCTCGGCGACATGGTTGCCGATTG
CCAGCACAAGTTCCGGCTCGTCATCGGCCCGCTCGATCTCGACCAATATCTTCGCCTGACGCCGCACGGC
AACGATCTGCCGACCCTGGTCGATTGGGTGCGCGCCTTCGTCGGTCACGAATACGACTGGGAGATCAAGC
TGCTCGTCAAGCCGCGCGCCGCGCCGCCCGCCCGCGCGGATACCACGCACCGCCTCGGCTATTCGACCTG
GCTCGGCGAATCGAGGGACGACAGGCCGGTCGTCGGCATGGTGTTCGAGCCGGAAAAATACTGTTCCTGA