SecReT6
Protein ID: 526457757
SecReT6 ID833
T6SS typei3
Gene symbol-
Locus tagBDL_6064
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3188490..3189071 [-]
Producthypothetical protein
NoteTssB
UniProt IDS5NEG4
KEGG IDbpse:BDL_6064
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-59, Aligned region: 11..164
Protein Sequence: 193 a.a.     [Download]
>gi|526457757|ref|YP_008329827.1| hypothetical protein BDL_6064 [Burkholderia pseudomallei MSHR305]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNF
DERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKS
GAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAKDAPDTANHDSDAA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c3189071-3188490 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGTCCGCATCCAGCAGCTCTCAAAAATTCATCGCGCGCAACCGCGCGCCCCGCGTGCAGATCGAATACG
ACGTCGAAGTCTACGGCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTC
GGGCAAGCCGGTCGCGCCGCTGCCCGCCGTCGCCGACCGGCGCTTCCTCGACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATCAAGCCGCGCGTGGCGTTCGCGGTGGACAACACGCTGTCGGGCGACGGGC
AGCTGATGGTCGACATGACGTTCGAAAGCATCGAGGACTTCTCGCCCGCCGCGATCGCGCGAATGGTCGG
CCCGTTGCGGCAATTGCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGGCAAGTCC
GGCGCCGAGACGCTCGTCAACCAGTTGCTGCAGGACCCGGCGCTGCTGCGCTCGCTCGCGGCCGCGCCGA
AGCCGCAGCTCGCGGGCGGGCCGGACGCGGGCAATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAA
CCACGACAGCGATGCGGCCTGA