SecReT6
Protein ID: 526457791
SecReT6 ID833
T6SS typei3
Gene symbol-
Locus tagBDL_6068
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3194301..3194828 [+]
Productlysozyme family protein
NoteTssE
UniProt IDS5NZP5
KEGG IDbpse:BDL_6068
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-18, Aligned region: 42..152
Protein Sequence: 175 a.a.     [Download]
>gi|526457791|ref|YP_008329831.1| lysozyme family protein [Burkholderia pseudomallei MSHR305]
MRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQRDLAFLLNTTSIDEHIDRE
RHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVVAPSRAAGAVARPNVLAFE
VRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 528 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3194301-3194828 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
GTGCGCGGCGAAGGCCTCGCGACGCCGCGCCGCGCGAACACGCAACTGCTGCCGACGCTGATCGACCGCC
TGCGCGACGACGCGCCGCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCG
CGGCATCGTCCAGCGTGATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAA
CGCCATCCGGCCGCCGCCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGT
CGTGCCAGTGGGCCGAGGTCGAACGCATCATCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGC
CGAGACGCTCGTCGTCGCGCCGTCGCGGGCCGCCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAG
GTGCGCGGCATGATTCGTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAA
CGAACCAGGTCAACATCACCGGCATGCGCGCGAGCTGA