SecReT6
Protein ID: 526457874
SecReT6 ID833
T6SS typei3
Gene symbol-
Locus tagBDL_6067
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3193295..3194260 [+]
ProductimpE family protein
NoteTagJ
UniProt IDS5NLE8
KEGG IDbpse:BDL_6067
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.80E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|526457874|ref|YP_008329830.1| impE family protein [Burkholderia pseudomallei MSHR305]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFHARVMAGHARPGFVFDASPWIDDLLEALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFSDLAGWRLARPGVPLDLVWAPCVLTLADGSV
AHGFMPARYPGSELADGSGVPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3193295-3194260 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGACGACGCCCGCCTTCCCGGCGCCGCCCGGCGCGCGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGTGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCACGCCCGCG
TGATGGCGGGCCACGCGCGGCCGGGATTCGTATTCGATGCGTCGCCGTGGATCGACGATCTGCTGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTTCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCCGCTCGATCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCGGCGCGTTACCCGGGCTCCGAACTGGCAGACGGGAGCGGCGTGCCGGGCGCCT
CGGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGCGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA