SecReT6
Protein ID: 526457905
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4806
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1648304..1649041 [-]
Producthypothetical protein
NoteVirG
UniProt IDS5NM22
KEGG IDbpse:BDL_4806
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 1.50E-20, Aligned region: 10..117
Trans_reg_C [PF00486], Evalue: 9.70E-20, Aligned region: 161..235
Protein Sequence: 245 a.a.     [Download]
>gi|526457905|ref|YP_008328583.1| hypothetical protein BDL_4806 [Burkholderia pseudomallei MSHR305]
MTNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVL
LRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRA
YRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWR
LRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG
 
Nucleotide Sequence: 738 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c1649041-1648304 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGACGAATGCGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTT
GCAATTACCTGTCGGGCCACGGGATGGCCGTGGACGGGGTGGGAACGGCGGCAGCGGCCGCCGAATCGGT
CGGGCGGCGCGAATACGAGATGGTGCTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGATGTGCTG
CTGCGCTGGCGCGAAACGCAGCGCTTTCCGCTCATCTGCGTGACGGGGCGCAGCGAAGAGGCCGATCGCA
TCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAAGCCGTACTCGCTGCGCGAGGTGCTCGCCCG
GATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGCGCGGCAGGCATCCGCGTGCG
TACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCGCAGGAAATTC
CGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGG
CTGCGCAAGAAAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACT
ACTTCGACGCGAAAGAGGTGGAGACGCTATGGGGATGA