SecReT6
Protein ID: 526458019
SecReT6 ID831
T6SS typei3
Gene symbol-
Locus tagBDL_5569
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2588558..2589076 [-]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDS5NLV5
KEGG IDbpse:BDL_5569
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-38, Aligned region: 14..160
Protein Sequence: 172 a.a.     [Download]
>gi|526458019|ref|YP_008329332.1| type VI secretion lipofamily protein [Burkholderia pseudomallei MSHR305]
MRLRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTASAFESADF
FSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2589076-2588558 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCGACTGCGGTTCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTTGCCGGATGCGGGGCGACCG
AGCGTTCCGTTGCGGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGC
GCCCGGGGGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGA
ATATCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCCCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCC
TCGGCGGCGATTCGCGAGTACGCCAATGA