SecReT6
Protein ID: 526458114
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3744
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]268083..269594 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5NM61
KEGG IDbpse:BDL_3744
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|526458114|ref|YP_008327530.1| hypothetical protein BDL_3744 [Burkholderia pseudomallei MSHR305]
MSMQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIE
QLVAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVW
DQSPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWS
ELSNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFC
WANSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSES
GLMPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSA
EDTQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRL
VSKLPSTKHEVTT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|526456747|ref|NC_021877.1|:268083-269594 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAGTATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATC
TGAAGGACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAGGCGGTGCAGAACGCGGT
CGAGACGCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAG
CAGCTGGTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTC
AGAGCCTCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAA
GATCCGCTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGG
GATCAGAGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTGATCGGCGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGAT
CTCGGCGGCCGCTCACGCGCCGTTCATCGCGGCCGCCGCGCCCGGCCTGCTGCAGATGGACGACTGGAGC
GAGCTGTCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAATATGCGTTCTGGCGGCGCCTGC
GCGAGAGCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCC
GAAGACGCAGCCCGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGACCCGAACCGTGCGGAGGATTTCTGC
TGGGCGAACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGA
AGATTCGCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCG
CGAAGTCGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCG
GGCCTGATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATC
GTCCGGCGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTT
CGCGACCTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCC
GAGGACACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCG
AGGTGACGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGG
CTACTATCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTG
GTTTCGAAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA