SecReT6
Protein ID: 526458164
SecReT6 ID831
T6SS typei3
Gene symbol-
Locus tagBDL_5557
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2570723..2572201 [-]
Producthypothetical protein
NoteTssG
UniProt IDS5NM97
KEGG IDbpse:BDL_5557
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.00E-130, Aligned region: 85..439
Protein Sequence: 492 a.a.     [Download]
>gi|526458164|ref|YP_008329320.1| hypothetical protein BDL_5557 [Burkholderia pseudomallei MSHR305]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANAEANAEPDAMPNALRGAAADVAPSAAPSATPNATPSATS
QAAAARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVR
DDGPRPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSL
DRPARARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSPPDSSPDSPPDSRSDSPSDARLDP
HPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRP
TQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEV
PTLALGSRHGLGRTAWLGERLDPGPARDLVLGYDERMRASRARSGAADQAAAAGALIANLPEREPPCPIS
AE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2572201-2570723 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAACGCGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCGCTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCAAATGCAACGCCGAGCGCGACGTCG
CAGGCCGCCGCCGCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGT
TTCATGCGCTGCGTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCG
CGACGAGCCGGTGCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGT
GACGACGGCCCGCGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGT
CGCATCTGACCGAGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGA
CCTGTTTCATCATCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTC
GATCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTG
CCGATTCACCGCGCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACC
GCCTGATTCATCGCCTGATTCGCCGCCTGATTCGCGGTCCGATTCGCCGTCCGATGCGCGCCTCGATCCG
CATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGG
TGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCAT
CGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCG
ACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGC
TCGGCCCGCTGACGCTCGACGAATACCGGCGGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCA
ATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTG
CCGACGCTCGCGCTCGGTAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGACCCCG
GCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGC
CGATCAGGCGGCCGCCGCCGGTGCGTTGATCGCCAACCTGCCTGAACGGGAACCGCCATGTCCGATATCG
GCCGAGTGA