SecReT6
Protein ID: 526458171
SecReT6 ID833
T6SS typei3
Gene symbol-
Locus tagBDL_6069
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3194871..3196748 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5P0R2
KEGG IDbpse:BDL_6069
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-214, Aligned region: 1..622
Protein Sequence: 625 a.a.     [Download]
>gi|526458171|ref|YP_008329832.1| hypothetical protein BDL_6069 [Burkholderia pseudomallei MSHR305]
MLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPRFTGR
LLEVLYPNYVAPTPSMAVARLYPSRTEGNLAQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYPLEIA
DARLTGIPPDIPALDRYVPAGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFELLHVA
GVATLTAAPGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVALTGL
EEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSSGQTECHLVPARLAP
LDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDFARRYGTRTPYVGTEMF
VSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVPRDGVRDLTAIESAPIDSVGLIRAPSAPKAPYAEREI
AWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGPLVFG
RGVECALSVDEAGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3194871-3196748 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
TTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGGCGCCGAGTTCGCGCGCGCGCACC
CGAAGATTGCGCGGCGCCTCGGAATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGAGCGGCTGATCGA
ATCGTTCTGCTTCATGGCCGCGCGCATGCAGATCAAGCTCGATGCGGAATTTCCGCGCTTCACCGGCCGC
CTGCTCGAGGTGCTCTATCCGAACTATGTCGCGCCGACGCCGTCGATGGCGGTCGCGCGCCTGTACCCGA
GCCGCACCGAAGGCAATCTCGCGCAAGGCTTTCGCGTCGCGCGCGGCACCGCGTTTGCCGCGCGCGTGCC
GGCCGGCGAGAAAACCGCGTGCCGGTTTCGCAGCGGCCAGGACGTGACGCTCTATCCGCTCGAGATCGCC
GACGCGCGGCTGACGGGGATTCCGCCGGACATCCCGGCGCTCGACCGCTACGTGCCGGCCGGCGCGCAGG
TGCGCGGCGCGCTGCGCCTGCGGTTGCGCACGACCGGCAACATGCGCATCGCCGATCTGCGGGGCCTCGA
CCGGCTGCCGCTGTATCTCGCGGGCGACGCTCAGGTGGCCTCGCACCTGTTCGAGCTGCTGCACGTGGCC
GGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCGGGCCGCCCGCCCGCGGCGGTTACCG
TCGACGCGCTCGCTCACGAAGGGCTCGGCGCCGACGAGGGGCTGTTGCCGCTCACGTGGGCGAAGTTCCA
TGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCGCTGACGGGGCTC
GAGGAAGGGTTGCGGCGCATCGCGGGCAGCGAGGTCGAAATCGTCGTGCTGCTCGAACAATCGCCCGAGC
GGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAACCTGTTTCCGCG
CCACATGGACCGGATCGAACTGTCGAGCGGGCAGACCGAATGCCATCTGGTGCCGGCCCGCCTCGCGCCG
CTCGACTACGAAGTATTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACATCGGCCGAACTCGAGT
TCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTCGACGCGGCGCGA
GCGCCGGCTCGTGTCGGATTTCGCGCGCCGCTACGGCACGCGCACGCCGTACGTCGGCACGGAGATGTTC
GTATCGCTCGTCGATCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTATCTGTCGGTGGACGCGCTGG
TGACGAACCGCGACCTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGACCTCACGGCGATCGAATCCGC
GCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCGGAGCGCGAGATC
GCGTGGCGGCTGATCCGCCAGTTGAACTTCAACTATCTGCCGCTCGACGAGCTCGACCATCGCGCGGGCG
GACAGGGCCTGCGCGGCCTGCTGCGGCTGTTTCTGGCGGGCGACGAGGCCGACAGCCGGCGGCAGGTGGA
AAGCCTTGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCGCTCGTGTTCGGG
CGCGGCGTCGAGTGCGCGCTGAGCGTCGACGAAGCGGGCTTCTCCGGCGTGAGCCCGTATCTGTTCGGGC
TCGTGCTCGAGCATTATCTGGCGCGGCACGTGTCGATCAACGTGTTCACGCAGACCGAGCTGAACTCGAT
CCAGCGCGGCCGCATCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGTGCGTGA