SecReT6
Protein ID: 526458444
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4813
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1656109..1657131 [+]
Producthypothetical protein
NoteTssG
UniProt IDS5NMW1
KEGG IDbpse:BDL_4813
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-80, Aligned region: 11..311
Protein Sequence: 340 a.a.     [Download]
>gi|526458444|ref|YP_008328590.1| hypothetical protein BDL_4813 [Burkholderia pseudomallei MSHR305]
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVERIDKADDGG
YRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDE
HALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVPQWLPIP
DDQRTRVGARAHRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAV
DVVVRVRARDAAPARCGGRVWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1656109-1657131 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCGCGTATTTCCAGGCGATCCGGCTGC
TGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCCCGACGCGCCGCTGCCGATCCACAC
GCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGCATCGACAAGGCCGACGACGGCGGC
TACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGCCGCTGCCGACGTTCTACACCGAGG
ACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTTTCTCGACGTGCTGCATCGCGCGCT
CTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTGCGGATCGTCGAGGAACGCGACGAG
CACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCGACGCGCGCATCGCGCGCGACGCGGGCCTGCACG
AGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCGCTCCGCGGCCGGTCTGCGCGCGCT
GCTCGCCGACGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGCGTGCCGCAATGGCTGCCGATTCCG
GACGACCAGCGCACCCGCGTCGGCGCGCGCGCGCACCGGCTCGGCGCCGACGCGCGGGTCGGCGCGCGCA
TGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCCCGGCCCGCTGTTCCGCGCGCTGAT
GCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTGTATCTGACCCAACCGTTCGCCGTG
GACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCTGCGGCGGCCGCGTGTGGTCGCGCG
TCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGCGTCGCCCGAATTCCGTCTTCCGAC
TTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA