SecReT6
Protein ID: 526458523
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4820
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1668145..1668942 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDS5P7Q1
KEGG IDbpse:BDL_4820
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-25, Aligned region: 46..208
Protein Sequence: 265 a.a.     [Download]
>gi|526458523|ref|YP_008328597.1| type VI secretion lipofamily protein [Burkholderia pseudomallei MSHR305]
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAP
DALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPG
QHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITD
AREAPLNLPPPGARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ
 
Nucleotide Sequence: 798 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1668145-1668942 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCGGCCGATGCAGCCCGGCCGGCCGT
CATGGCCGTCGCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCTGCCGTGCTCGTCGCGCTCGCCGC
CCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCC
GACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACCTGAACGCGCCGCACACGCTGT
TGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGCCGACGATCCGGACCGGCTGCG
CATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCCGCTACGTCGTCGCGCCCGGC
CAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCCGGCTACTACG
ACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATCGACAAGCGCGGCTGGTTCTC
CTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCGGCGCGCAGAGCATCACCGAC
GCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGACGGCGCTCGACAGCGGCGCGA
AAACCCTGGCGCTGCCGAGCGCCGACGCGAACGACGGCGGCAGCGGCAAGCGCGACAAACGCGGCAACGC
CGCCGCCCGTGCGCCGCGCAAGCAATGA