SecReT6
Protein ID: 526458598
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3756
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]285706..286287 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDS5P7Z0
KEGG IDbpse:BDL_3756
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-12, Aligned region: 15..150
Protein Sequence: 193 a.a.     [Download]
>gi|526458598|ref|YP_008327542.1| type VI secretion lipofamily protein [Burkholderia pseudomallei MSHR305]
MGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADWLPTQ
GGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEGRGLI
HMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKTTYGTRRSRQ
 
Nucleotide Sequence: 582 bp     [Download]
>gi|526456747|ref|NC_021877.1|:285706-286287 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCTCGGCCTTCTCGT
CGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCTGAACGTCGCGCC
GACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGGCTGCCGACGCAG
GGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACTCGCGGCACGTGA
TCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTGGCTCGTCGCCGA
CGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGCCGCGGCTTGATT
CACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCGTGCCCGTCGGCG
GCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAAAACCACCTATGG
GACAAGGAGAAGCAGGCAATGA