SecReT6
Protein ID: 526458755
SecReT6 ID832
T6SS typei3
Gene symbolclpV
Locus tagBDL_5952
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3053401..3056046 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDS5NPI0
KEGG IDbpse:BDL_5952
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.70E-39, Aligned region: 230..310
AAA_2 [PF07724], Evalue: 8.70E-39, Aligned region: 608..773
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 232..363
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 613..697
ClpB_D2-small [PF10431], Evalue: 1.80E-15, Aligned region: 440..457
ClpB_D2-small [PF10431], Evalue: 1.80E-15, Aligned region: 780..853
AAA_5 [PF07728], Evalue: 5.90E-15, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 5.90E-15, Aligned region: 612..730
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 377..398
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 583..655
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 677..696
Sigma54_activat [PF00158], Evalue: 3.20E-09, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 3.20E-09, Aligned region: 612..711
AAA_22 [PF13401], Evalue: 5.80E-08, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 5.80E-08, Aligned region: 611..635
AAA_22 [PF13401], Evalue: 5.80E-08, Aligned region: 674..699
AAA_19 [PF13245], Evalue: 2.10E-07, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 2.10E-07, Aligned region: 610..634
AAA_17 [PF13207], Evalue: 8.40E-06, Aligned region: 232..271
AAA_17 [PF13207], Evalue: 8.40E-06, Aligned region: 612..650
AAA_18 [PF13238], Evalue: 1.40E-05, Aligned region: 232..293
AAA_18 [PF13238], Evalue: 1.40E-05, Aligned region: 613..644
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 232..254
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 605..652
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 224..251
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 610..637
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 232..260
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 612..639
AAA_25 [PF13481], Evalue: 9.10E-05, Aligned region: 232..256
AAA_25 [PF13481], Evalue: 9.10E-05, Aligned region: 436..485
AAA_25 [PF13481], Evalue: 9.10E-05, Aligned region: 610..638
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 223..252
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 612..632
AAA_14 [PF13173], Evalue: 0.00024, Aligned region: 232..312
AAA_14 [PF13173], Evalue: 0.00024, Aligned region: 611..699
TIP49 [PF06068], Evalue: 0.003, Aligned region: 232..258
TIP49 [PF06068], Evalue: 0.003, Aligned region: 292..312
TIP49 [PF06068], Evalue: 0.003, Aligned region: 611..647
DEAD [PF00270], Evalue: 0.0035, Aligned region: 220..245
DEAD [PF00270], Evalue: 0.0035, Aligned region: 304..317
DEAD [PF00270], Evalue: 0.0035, Aligned region: 376..401
DEAD [PF00270], Evalue: 0.0035, Aligned region: 612..792
RNA_helicase [PF00910], Evalue: 0.0038, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0038, Aligned region: 613..634
T2SE [PF00437], Evalue: 0.0062, Aligned region: 222..252
T2SE [PF00437], Evalue: 0.0062, Aligned region: 608..681
NTPase_1 [PF03266], Evalue: 0.0088, Aligned region: 232..254
NTPase_1 [PF03266], Evalue: 0.0088, Aligned region: 612..634
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 232..244
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 610..630
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 230..251
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 303..312
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 574..633
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 681..705
UPF0079 [PF02367], Evalue: 0.0097, Aligned region: 232..252
UPF0079 [PF02367], Evalue: 0.0097, Aligned region: 610..638
Protein Sequence: 881 a.a.     [Download]
>gi|526458755|ref|YP_008329715.1| type VI secretion ATPase, ClpV1 family [Burkholderia pseudomallei MSHR305]
MTVSRQALFGKLGYSLFRSIESATAFCKLRGNPYVELVHWLHQMLQAADGDMQRIARHCDIDLGELERDM
VRALGELPAGASSISDFSHHIETAIERAWVLATLDFGDRRIRGAWLLAALLKTPELRRVLLSISSAFGRI
RVDELDAMLPAWIDGSPEANETPYDDSDFGAAIPGEASSAMQQKGGGSPLEQFCLDLTARARAGQIDPVV
GRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAIAAGDVPPKLADARLLSLDVGALLAGASM
KGEFEARLKGVLEAAAKATLPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTLRTIGATTWAEYKR
HIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLTRTFSRHHGVVVLDEAIRAAVKLSHRYIPSRQLPDKAI
SLLDTACARVALSQHAPPRELQDVRRRLEAARVRLELLDGEQRIGLGDEAALAQSRAEIAALEVEEQSID
ACWRQQIEAAQTLLSAREAAGDAAASAIDALRELEHALSNLQGDHAFVFPEVNEAIVAEIMSDWTGIPVG
RMVTDEVSAVRALPDTLAARVIGQRDALHQIGDRVQTARAGLTDPKKPLGVFLLAGPSGVGKTETALALA
EALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEM
FFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLVSGLCMDEVCAPDADGLCAALASELLKTFPAAFLG
RVTLVPYRPLAQETLSRIVRLHLDRVVTRMAENQGVVLRYSDNVVDYVVNRCLVQETGARLLIGFIEQHV
LPLLAKLWLDSLASKHVLTRVDLDVADPAAAPTEAFALRAS
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3053401-3056046 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGACAGTTTCAAGACAGGCACTATTCGGCAAGCTCGGCTACTCGCTGTTTCGCAGCATCGAATCGGCGA
CGGCGTTCTGCAAGCTTCGCGGCAACCCTTACGTCGAGCTGGTGCATTGGCTGCATCAGATGCTTCAGGC
CGCTGACGGCGATATGCAGCGGATCGCTCGCCACTGCGACATCGACCTCGGCGAGCTGGAGCGCGACATG
GTGCGCGCGCTCGGCGAACTGCCGGCGGGCGCGAGCTCGATCAGCGATTTCTCGCACCACATCGAGACGG
CGATCGAGCGCGCGTGGGTGCTGGCGACACTGGACTTCGGCGATCGCCGGATTCGCGGCGCGTGGCTACT
GGCTGCGTTGCTGAAGACGCCGGAGCTCAGGCGCGTACTGCTGTCGATTTCGTCCGCGTTCGGCCGGATT
CGTGTCGACGAACTGGATGCGATGTTGCCGGCCTGGATCGACGGCTCGCCCGAGGCGAACGAGACGCCGT
ACGACGACAGCGACTTCGGCGCGGCCATACCGGGCGAGGCGTCGAGCGCGATGCAGCAAAAGGGCGGCGG
TTCACCGCTGGAGCAGTTCTGCCTCGATCTCACCGCGCGAGCGCGAGCGGGGCAGATCGATCCGGTCGTC
GGTCGTGAGCTGGAAATCCGCACGATGATCGACGTCCTGTTGCGCCGCCGCCAGAACAACCCGCTGCTGA
CGGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCGCGCGATCGCCGCCGGCGATGT
GCCGCCGAAGCTTGCCGATGCGCGCCTGCTGAGCCTCGATGTCGGCGCGCTGTTGGCCGGGGCGAGCATG
AAGGGCGAATTCGAGGCGCGCCTGAAAGGCGTGCTGGAGGCGGCGGCGAAAGCGACGCTGCCCGTCATTC
TGTTTGTCGACGAGATTCATACGCTGATCGGCGCGGGCGGCCAGGCGGGCACCGGAGATGCCGCGAACCT
GCTCAAGCCCGCGCTCGCGCGCGGCACGCTGCGAACGATCGGTGCGACGACGTGGGCGGAATACAAGCGG
CACATCGAAAAGGATCCGGCGCTCACACGCCGCTTCCAGGTGTTGCAGGTTCCCGAGCCCGACGAGGCGG
CCGCGATCGACATGGTTCGAGGGCTGACGCGAACCTTCTCGCGTCATCATGGCGTCGTCGTGCTGGACGA
GGCGATTCGCGCGGCGGTCAAGCTGTCGCATCGCTACATTCCATCCCGTCAGTTGCCGGACAAGGCGATC
AGCCTGCTCGATACGGCGTGCGCGCGCGTCGCGTTGTCGCAGCATGCGCCGCCGCGTGAGCTGCAGGACG
TCCGCAGAAGATTGGAGGCCGCGAGGGTGCGGCTCGAATTGCTCGACGGCGAGCAGCGCATCGGCCTTGG
CGACGAAGCCGCGCTCGCGCAGTCTCGCGCGGAAATCGCCGCGCTCGAGGTGGAGGAGCAATCGATCGAC
GCTTGCTGGCGGCAGCAGATCGAGGCCGCGCAGACGCTGCTCAGCGCGCGCGAGGCGGCGGGCGACGCTG
CGGCGAGCGCGATCGACGCGCTGCGCGAGCTGGAGCATGCGCTGTCGAACCTGCAAGGCGATCACGCGTT
CGTTTTCCCCGAGGTCAACGAAGCGATCGTCGCGGAGATCATGTCCGACTGGACCGGCATTCCGGTCGGC
AGGATGGTGACGGACGAAGTGTCCGCCGTGCGCGCCTTGCCGGACACGCTCGCCGCCCGCGTGATCGGTC
AACGCGATGCGTTGCATCAGATTGGCGATCGGGTGCAAACGGCGCGCGCCGGATTGACCGATCCGAAGAA
GCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCGTCGGCAAGACGGAGACGGCATTGGCGCTTGCC
GAGGCGCTGTACGGCGGCGAGCAGAATCTCATCACGATCAACATGAGCGAATATCAGGAGGCGCATACGG
TATCGGGGCTGAAGGGCGCGCCGCCGGGTTACGTCGGATACGGCGAGGGCGGCGTGCTGACCGAGGCGGT
GCGCAGGCGTCCGTATTCCGTCGTGCTCCTCGACGAGATCGAGAAGGCGCATCCCGACGTCCACGAGATG
TTCTTCCAGGTATTCGACAAGGGCTACATGGAGGACGGCGACGGGCGCTATATCGATTTTCGCAACACGA
CGATTCTTCTCACCAGCAATGCAGGCTCCGACCTCGTGTCCGGACTGTGCATGGACGAGGTTTGCGCTCC
CGACGCGGACGGCCTTTGCGCCGCGCTCGCTTCCGAATTGCTCAAGACGTTTCCCGCGGCGTTTCTCGGG
CGCGTGACGCTGGTGCCCTATCGTCCGCTCGCGCAGGAAACGCTATCGCGCATCGTCCGGCTGCATCTGG
ACCGAGTGGTGACGCGAATGGCCGAGAATCAGGGTGTCGTCCTGCGTTATTCGGACAATGTCGTCGATTA
CGTCGTCAATCGCTGCCTCGTGCAGGAAACGGGGGCGCGCTTGCTGATCGGCTTCATCGAGCAGCACGTG
TTGCCGCTGCTCGCGAAGCTCTGGCTGGATTCGCTTGCGTCCAAGCACGTGCTGACACGCGTCGACCTCG
ACGTGGCCGATCCCGCCGCGGCCCCGACCGAAGCGTTCGCGCTGCGCGCTTCATGA