SecReT6
Protein ID: 526458771
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5937
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3030348..3031697 [+]
Producthypothetical protein
NoteTssK
UniProt IDS5P2B0
KEGG IDbpse:BDL_5937
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|526458771|ref|YP_008329700.1| hypothetical protein BDL_5937 [Burkholderia pseudomallei MSHR305]
MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAGIFP
DGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQG
PKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGL
AKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFV
RPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLV
LAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3030348-3031697 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTCAACAACAGG
AACGGTACTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGGATTCAGCCG
ATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGAATATTTCCC
GACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATTGCCGCCGAGCATC
AGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTGCCGAATACAGAGGAGACCGCGTTCGACGAACA
AGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATCGGTCAAGGG
CCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGCAGTCCTGGA
TCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGCTCGGTCGCGCTGTACGACGGTGACCA
CATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTGCACGGCCTC
GCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGGCGGCGGCCG
AGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAGCCGCTGCTCGAGCACATCTGCAGGAT
TCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCGACGTTCGTG
CGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGAGCATTCGCC
CGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGATCCCGCTCAC
CGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCGAGCCTCGTG
CTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAGACGAAGATCAGCC
ATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTTGCCGGTGCC
TCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCGTTCTGGGAA
CAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGCTCGAACTTT
GGGGAGTGCGTCACAAATGA