SecReT6
Protein ID: 526458798
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3746
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]270345..270776 [+]
Productlysozyme family protein
NoteTssE
UniProt IDS5P8C5
KEGG IDbpse:BDL_3746
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-11, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|526458798|ref|YP_008327532.1| lysozyme family protein [Burkholderia pseudomallei MSHR305]
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQMAGATKINP
VHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKAREDGAELRASLALDYLSGYFSLA
DDR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|526456747|ref|NC_021877.1|:270345-270776 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
GTGAGCGATCTTCAACTCTACAACAAGCTGTCGAAACGGATTCGTCGCCATTCGCTGCAAGAGGTCGTGG
CCGACCACTTGGTCGATCTGATGAATCACGCGATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCC
GGCCGCGCATTCGGTGCTGAACTTCGGTTGTCCGCCGATGCAGATGGCCGGTGCGACGAAGATCAATCCG
GTTCATGCGGCCGCGCATATCTGCGAGGTGATTCGCCGCTTCGAGCCGCGCGTGGACCCTGCCAGCACGG
TGGTCAAGCCGCGCACGGAGAGCCGCAAGCGCCTCGCGCAGACGATTTATTTCGACGTGTCGATGAAGGC
GCGCGAAGACGGAGCCGAACTCAGGGCGAGCCTCGCGCTCGACTATCTGAGTGGTTATTTCAGCCTGGCG
GACGACCGATGA