SecReT6
Protein ID: 526458893
SecReT6 ID830
T6SS typei1
Gene symbol-
Locus tagBDL_4812
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1654379..1656121 [+]
Producthypothetical protein
NoteTssF
UniProt IDS5P8K0
KEGG IDbpse:BDL_4812
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-160, Aligned region: 7..580
Protein Sequence: 580 a.a.     [Download]
>gi|526458893|ref|YP_008328589.1| hypothetical protein BDL_4812 [Burkholderia pseudomallei MSHR305]
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDEGLPELV
QALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCR
FVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCA
LGARALRPAGFDDALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPD
WLPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHY
VPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTIGHLALNFLSLGDADHLKRMLALHAFGERGDDARAQAD
RRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEID
ASPDGVRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1654379-1656121 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGCCACCACCACGCCCAATCGCTATTACGAGGACGAGCTCGTTCGCCTGCGCGAGCTCGCCGCCGAGT
TCGCCCGCGCGCACCCGCTGCTCGCGCCGATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAGCGGCT
GCTCGAAGGCGTCGCGTTCCTGACGGGGCTCGCGCGGCAAAAGCTCGACGAAGGCCTGCCGGAGCTCGTG
CAGGCGCTCGCGAACCTGCTGTTTCCGCACTCGCTGCGCCCGGTGCCGGCGGCCACGCTGATCGCGTTCG
AGCCGCGCGGCGCGCTGCGCGAGCGCGCGGTGATCGCGGCCGGCACCGAGATCGAATCGGTGCCCGTCGA
CGGCACCGCCTGCCGGTTTCGCACGTGCGGCGAGCTGGACATCGAGCCGATCGCGCTCGCCGGCTGCCGG
TTCGTGCCGCCCGCGCACGGCGGGCCCGCGCTGCGGCTCGACTTCGAGATGCTCGGTCTCGACGCGAGCG
AATGGGACGCGACGCGCATTCGCCTGTTCATCGGCGGCGAGCGGCTGCACGCAAGCCGCCTGTTCGCGCT
GCTGATGCAGCACGTCGTAGCGGTCGAGATCGCGGGCGGCCCGCCCGAGCTGCCCGGCCCGCGCTGCGCG
CTCGGCGCCCGCGCGCTGCGCCCGGCGGGCTTCGACGACGCGCTGCTGCCCTGCCCCGAGCGGGCGTTCC
CCGGCTTCCGGCTGCTGCACGAATATTTCGCGTTCGCCGAGAAATTCCTGTTCGTCGAGCTGGGCGGCCT
CGAGCGCTGGCGCGCGGCGCGCGCGGGCGCGCAGTTCAGCGTATGGCTCGCGCTCGACAGCGCGCCCGAC
TGGCTGCCCGGCATCGATCGCGACAGCTTCCGGCTGAACGTCGCCGCCGCGCTGAACCTGTTCGCGCACG
AAGCGGTGCCGATCCAGCACGAGCATCGCGCGACCGATTACCGGCTGCAGCCCGAAGGCGACACGTCGGG
CCACTACCGGATCTACTCGGTCGACCGCGTGATCGGCTACCGCCCCGGCCACGCGGTCGACCGCCATTAC
GTGCCGTTCGGCGTCGCGGGCGACGACGCGAACGCCGCGAGCTACCGGCTGATTCGCCGCGCCGCGCTCG
ACGGCCACGGGCAGGATCTCCATCTGGCGCTCGCCTACCCGCCCGGCGAGGCGCTCGCCACGGAAACGCT
GTCGATCGGCCTGTCGTGCACGAACGGCGCGTTGCCCGCGCGCCTGAAGATCGGCGACGTGTGCCGCGCG
ACCGACAGCTCGCCCGAGCGCTTCACGTTCGCCAACATCGCGCCCGTGAGCCCGCCGCTCGATCCGCCGC
TCGGCGAACCGCTGCTGTGGCGCACCATCGGCCATCTCGCGCTGAACTTCCTGTCGCTCGGCGACGCCGA
CCATCTGAAGCGCATGCTCGCGCTCCACGCGTTCGGCGAACGCGGCGACGACGCGCGCGCGCAAGCCGAC
CGCCGCCGCATCGACGGCATCGAATCGGTCGACGTGCGTGCCGAGACGCGGATCATCGGCGAGCGGATGC
TGAGCGGCCAGCGCGTGGCGCTGCGCTGCAGCGCCCATGCGTTCGGCGGCGCGGGCGAGCTGTATCTGTT
CGGCTGCGTGCTCGAGCGCTTTCTGGCCGAATACGCGGCGATCAACACCTACACGCGCGTCGAGATCGAC
GCGTCGCCCGACGGCGTGCGCTTCGCGTGGCCGCCGCGGATGGGGGCGCAATGCCTGCTCTAG