SecReT6
Protein ID: 526458912
SecReT6 ID832
T6SS typei3
Gene symbol-
Locus tagBDL_5938
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3031694..3032995 [+]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDS5NHD9
KEGG IDbpse:BDL_5938
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-61, Aligned region: 62..268
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 21..36
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 327..425
Protein Sequence: 433 a.a.     [Download]
>gi|526458912|ref|YP_008329701.1| type VI secretion system OmpA/MotB family protein [Burkholderia pseudomallei MSHR305]
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRIDASVNVQHRLDEVRAAANPLLEAATP
LLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGG
VWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQR
LWTLITGARDAIQPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARIL
AIAKDEPAPPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREV
ARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3031694-3032995 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAATTCGGGCGCCTTTGACGAAGCCGCGTTCGATTTTCTCGTATCGGACGAAGGCGGAGCGAACGTCG
CGGCCGATCGCGCGCGATCGGCCGCGAAGGCCGCGGGCGCGGAGCCGGCGCGCGATCGGATCGACGCGTC
GGTCAACGTCCAGCATCGCCTCGACGAAGTTCGCGCGGCGGCCAATCCGCTGCTCGAAGCCGCGACGCCT
TTGCTGCGGATGCTGGCGGACATGCCTGCGACGCTAGACACCTCCGAAGCCGTCGCGAGCCTTCGCACGC
TGCTCGTGCGCGAGGTCGCGCTGTTCCAGAACTTGTGCGAGAAGGCCGATTTGCCTTGGAAGCACATGGC
GGTCGTGCGTTATTGCCTGTGCACGGCACTGGACGAGGCGGCCAATCGCACGCGCTGGGGCGGCGGCGGC
GTATGGGCTTCGCAGAGCTTGCTGATTACATACGAAGGCGAGGTCGACGGAGGCGAGAAGTTCTTCCTGT
TGATCGGACGCATGGCGACGGATCCGCAGGAGTACGTCGATATTCTCGAGATTCTCTATCGCGTGCTGGG
TCTCGGGTTCGAAGGGCGCTACAGCGTCGTTGCGGACGGCCGGCGGCATCTCGAGCAGATTCGCCAGCGT
TTGTGGACGCTCATCACCGGCGCGCGCGACGCGATTCAGCCGGAATTGTCGCTGCGCTGGCGCGGAGCGG
AGCCGGGCAGGCTTCCGCTGTTGCGCAGCGTGCCCGCATGGGCGAGCGGTGCGCTCGTCTTCCTGCTGTT
GTTCGGTCTCTTCGCGTTCTATCAGTATCGGTTGCTCACCGAACGCAATGCGCTCGAGGCGCGCATCCTG
GCGATCGCGAAGGACGAGCCGGCGCCGCCACCGCAGCGTTTGCGCCTGTCGATCCTGCTCAAGAACGAAA
TTGCGCGTGGTCTACTGACGGTCGACGAAGACGATAGGCGCAGCGTGGTCGTGTTCCGCGGCGATTCGAT
GTTCCGCTCCGGCGAGAGCCGCGTGCTTCCCGAGATCGAGCCGGTGCTCGACAAGGTGGCGCGGGAAGTG
GCCCGCGTCGGCGGCCGGGTCACGGTCACGGGGCACTCCGACAACCAGCCGATTCGGCGCGCCGACATCC
CGAACAATCTCGTGTTGTCGGAAAAACGCGCGGCTTACGTCGCGCAAATCCTGGTCCAGCGAGGCACTCC
GGCCGATCGTATTCGCTCGGAGGGCCGGGGCGACGCGCAGCCCGTCGCGGAAAACGCGACGCCTGCTGGC
CGATCCCGCAACCGCCGCGTCGAAATCGCGGTCACGCTGTAA