SecReT6
Protein ID: 526458984
SecReT6 ID831
T6SS typei3
Gene symbolhcp1
Locus tagBDL_5560
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2574653..2575144 [-]
Productprotein hcp1
NoteTssD
UniProt IDS5NPB6
KEGG IDbpse:BDL_5560
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-34, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|526458984|ref|YP_008329323.1| protein hcp1 [Burkholderia pseudomallei MSHR305]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2575144-2574653 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGGCGTCGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGACGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCATGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCGTACATGGACAAGGGCGCAACGGCGATCATC
AAGAACTGCGCGAGCGGCAAGCACCTGCCGACGGTCGAGATATCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTGGACCCGGG
CGACGCGGCCGACCGGCTGATGATGCAGTACGGTTTTCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAAGTGTCGGTCGGCTGGAACATCAAGGAGAACACCGAGATGT
GA