SecReT6
Protein ID: 526459023
SecReT6 ID831
T6SS typei3
Gene symbol-
Locus tagBDL_5568
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2587158..2588561 [-]
Producthypothetical protein
NoteTssK
UniProt IDS5P8W5
KEGG IDbpse:BDL_5568
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-159, Aligned region: 30..466
Protein Sequence: 467 a.a.     [Download]
>gi|526459023|ref|YP_008329331.1| hypothetical protein BDL_5568 [Burkholderia pseudomallei MSHR305]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGRGGDGNA
HAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYI
PPRLVAQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAA
HPETLFCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGN
GMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2588561-2587158 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCTGCTGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGCACTGGGAGCGCTACGTCGGCATGCGCTGCCT
GCCGCTGCAAGGCTTCTACTGGGGCTACGACGAGTTGCAGATCGATCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGCTGCTCGCCGCGACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGACC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGCGGGCGGCAACGGCGAAGGCCGCGGCGGCGACGGCAACGCG
CACGCGGGCTTCGCGCGCTACGTCGTGCGCGAATACGAAGTCGCCGACGCGAACGAGGTCGCGCTCGGCC
CCGCGCTATTGCAGACCGGCCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTGGCA
GGCGCTCGGCGTCGCGCGCGTCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTACATT
CCGCCGCGGCTCGTCGCGCAGCGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCA
CGCAACGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAACCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGA
TTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGATGTCGCCGCG
CACCCGGAGACGCTGTTCTGCGATTGGCTGAAGCTCGCGTGCGACCTGAGCACGTTCACTGCGGCCGGCC
GCCGGCCGCAGTCGCTCGCGGTCTACCGGCACGACGATCTGCGCGCGAGCTTCGGCGAGCTGATGGCCGA
GCTGCGCCGCTCATTGTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGTGGGCAAC
GGCATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGCGACACGGCGGGCTTCGTGCTCGCCGTGCGCG
CCGACGTGCCGGCCGACAGCCTGCGCGCGCGCTTTCCCGCGCAGGCGAAGCTCGGTCCCGTCGAGCGCAT
TCGCGATCTCGTGCAGTTGCAACTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCGCGGCAGATT
CCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAACAGCTCGAACGCT
CGGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGG
GTGA