SecReT6
Protein ID: 526459109
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3751
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]278959..281247 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDS5NPQ7
KEGG IDbpse:BDL_3751
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-70, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|526459109|ref|YP_008327537.1| Rhs element Vgr family protein [Burkholderia pseudomallei MSHR305]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDSNLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSKQLDSDAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQ
PFRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARFT
GVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVSTSITGSSNSVTGVSNSMT
GISSSWKDVSMSTTGQSESITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|526456747|ref|NC_021877.1|:278959-281247 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGACGCCGTCGCGCTGAGCTTCGTGGTGCATG
AGAACCTGTCGCAGGAGCCGTCGTATCAGCTCGATCTGCTGAGCCACGATTCGAATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGT
TGTCGTTTCTCGCTGAGAACCGCAACAGCCGGATCTTCCAGGATTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGACCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATTTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGGTCGAGCAGCAGAGCCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGACCCCGAGCAGGGCGAGCGCCTCGCGCGGCTGCGGCTCGAAGCGATT
CAGGCTGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTGGCGGTGGGTCGCGCGTTCACGC
TGGTCGGCCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATCCA
GGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCAG
CCGTTTCGGCCGCTGCTCGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGCC
CGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAGGCGGACGCGTCGTGCTGGATTCGCGTGACGCAGGCATGGGCGGGCAAGGGCTGGGGCGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTCATCGTCGTGTATGTCGACGGCGATCTCGACCGGCCGCTCG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTATGACCTGCCGAAGGATATCCGCTACACGGG
CCTCGTCACACGCTCGATCAAGCGGGCGGGCGGCATTCCGAATGCGAGCCAACTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCGA
CGTCGATCGCGCAGGATCTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGGTCAG
CTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGGTTCACG
GGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCACCGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGCTTCACCGGCGTCGCGACGTC
GATGGTGGGCGTGTCGACGAGCATCACGGGCTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCTTCCTGGAAGGACGTGAGCATGTCGACGACCGGCCAGTCCGAAAGCATCACGGGAGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGACGAG
CATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACATCGATGTCGACGACG
GGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGTTCGGTGGGCACGACGGGCTCGA
GCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACGGGAGCGAGCTACGA
GGATGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA