SecReT6
Protein ID: 526459131
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3745
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]269738..270265 [+]
Producthypothetical protein
NoteTssD
UniProt IDS5P358
KEGG IDbpse:BDL_3745
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|526459131|ref|YP_008327531.1| hypothetical protein BDL_3745 [Burkholderia pseudomallei MSHR305]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
 
Nucleotide Sequence: 528 bp     [Download]
>gi|526456747|ref|NC_021877.1|:269738-270265 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGTGAGTCGACCGATCAGCAAT
ATCCCGGTCTGATCCAGATCCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCGTCGCCG
AAGCTGTTCCTGATGTGCGCGACGGGTGAGCACATCCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAGTTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGTCACGCGAGCGGCGAAGTCGACGGCGTGCTGCCGACGGATCAGATCCGC
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCCGTGATCA
AGGCGGGCTACGACCTGAAGCAGAACGCGCCGATCTAA