SecReT6
Protein ID: 526459197
SecReT6 ID831
T6SS typei3
Gene symbol-
Locus tagBDL_5563
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2577346..2578425 [-]
Producthypothetical protein
NoteTssA
UniProt IDS5NI57
KEGG IDbpse:BDL_5563
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 56..116
Protein Sequence: 359 a.a.     [Download]
>gi|526459197|ref|YP_008329326.1| hypothetical protein BDL_5563 [Burkholderia pseudomallei MSHR305]
MQSSDPIESLLAGVAPDAPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWSAVERLALELTAR
TKDLRVAAHLARSWTELRGMPGYADGLRLVAGMLDRWWDDVHPRLDADGDHDPAPRANALAEIAGAHDCA
RAARRQALFDGGPSVRDAERVFDGRDGGEHGYPGGRERLIADLVRARDGGQPTLQAAFAALDALDAIRAR
VASALGGEWVPDASDFEKALRRIVRDGLPPPAAASAATNGAANVANAAHGGAANGVTNSAANGAASGGAP
AFAANGRAWRDAELTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESLPKL
DLLSGQRNE
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|526456747|ref|NC_021877.1|:c2578425-2577346 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCAGAGTTCAGACCCGATCGAATCGTTGCTCGCCGGCGTCGCGCCCGACGCGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAGAGCGCGACGCCGCGGCCCGAACAGCAGTACGGCGA
CACCGTGATCCCGGCCGAAGCGCCGGACTGGAGCGCGGTCGAGCGTCTCGCGCTCGAGCTGACGGCGCGC
ACGAAGGATCTGCGCGTGGCCGCGCATCTCGCGCGCAGTTGGACCGAACTGCGCGGCATGCCCGGCTACG
CGGATGGGCTGAGGCTCGTCGCGGGGATGCTGGACCGGTGGTGGGACGACGTGCACCCGCGCCTGGACGC
CGACGGCGACCACGACCCGGCCCCGCGCGCGAACGCGCTGGCGGAAATCGCGGGCGCGCACGACTGCGCG
CGCGCCGCGCGCCGGCAGGCGCTCTTCGATGGCGGCCCGAGCGTGCGCGATGCCGAGCGCGTGTTCGATG
GCCGCGACGGCGGCGAGCACGGCTACCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTTCGCGCGCG
CGACGGCGGGCAGCCGACGCTGCAGGCGGCGTTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGCGC
GTCGCATCGGCGCTCGGCGGCGAATGGGTGCCCGACGCGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGTTGCCGCCGCCCGCGGCCGCGTCCGCCGCGACAAACGGCGCGGCGAATGTGGCGAATGC
GGCGCACGGCGGCGCGGCAAACGGCGTCACGAACAGTGCCGCGAACGGCGCGGCTTCGGGCGGCGCGCCG
GCTTTCGCCGCGAACGGCCGCGCGTGGCGCGACGCGGAGCTGACGAGCCGCGACGACGTTCAGCTCGGCC
TCGAAAAAATGTGCCGCTACTTCGAGCTGCACGAGCCGAGCCATCCGGCGCCGATCCTGCTGCGCCGCGC
GCAGCGGCTGCTGTCGCTCGACTTCTACGAAATCATCCGGGATCTCGCGCCGGAGAGCCTGCCGAAGCTC
GACTTGCTGAGCGGCCAGCGCAACGAATGA