SecReT6
Protein ID: 526459208
SecReT6 ID829
T6SS typei3
Gene symbol-
Locus tagBDL_3750
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]276502..278793 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDS5P9F7
KEGG IDbpse:BDL_3750
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-71, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 4.50E-71, Aligned region: 691..717
Phage_base_V [PF04717], Evalue: 3.70E-23, Aligned region: 366..459
Protein Sequence: 763 a.a.     [Download]
>gi|526459208|ref|YP_008327536.1| Rhs element Vgr family protein [Burkholderia pseudomallei MSHR305]
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTGVSASF
TGLSTSFTGVSTSFTGVSTSFTGVDTSFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSM
TGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMST
TGSSTSVTGSSVSTTGSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|526456747|ref|NC_021877.1|:276502-278793 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAGCTTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGACCCGGATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTACCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAAGGGATTCCGCTCGAGTA
TTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAATCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGCTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGCCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGCATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCACTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGATCGCACAGGATCTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGAT
CAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGCTTC
ACGGGCTTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCG
TCGACACCAGCTTCAAGGGCGTGTCGACGTCGTTTACCGGTGTCGATACCAGCTTCAAGGGTGTGTCGAC
TTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTCGGTGACGGGCGTATCGAACAGCATG
ACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACCGGCCAATCCCAAAGCATCACGGGGG
TATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGAC
GAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACGTCGATGTCGACG
ACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACCGGCAGCTCGGTGAGCACGACGGGCT
CGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACGGGTTTCAGCTTCTCGTACACCGGCGTCAGCTA
TTCGGACACCGGTATCGACCTGAAGAAGGTCGGCATGCAAGTGAAGAGCTGA