SecReT6
Protein ID: 526459217
SecReT6 ID830
T6SS typei1
Gene symbolclpV
Locus tagBDL_4814
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1657118..1660165 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDS5NI73
KEGG IDbpse:BDL_4814
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.60E-42, Aligned region: 226..244
AAA_2 [PF07724], Evalue: 9.60E-42, Aligned region: 682..849
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 227..336
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 688..806
ClpB_D2-small [PF10431], Evalue: 5.60E-14, Aligned region: 854..926
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 687..801
AAA_22 [PF13401], Evalue: 1.00E-09, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 1.00E-09, Aligned region: 409..439
AAA_22 [PF13401], Evalue: 1.00E-09, Aligned region: 686..781
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 37..117
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 269..307
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 417..466
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 658..723
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 752..781
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 843..888
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 921..968
Zeta_toxin [PF06414], Evalue: 3.20E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 3.20E-06, Aligned region: 305..353
Zeta_toxin [PF06414], Evalue: 3.20E-06, Aligned region: 681..728
Clp_N [PF02861], Evalue: 1.20E-05, Aligned region: 28..75
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 462..507
AAA_25 [PF13481], Evalue: 1.20E-05, Aligned region: 683..708
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 116..131
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 438..467
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 587..602
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 685..719
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 888..912
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 219..253
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 687..723
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 276..374
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 686..708
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 686..803
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 227..249
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 687..723
ResIII [PF04851], Evalue: 0.00034, Aligned region: 210..246
ResIII [PF04851], Evalue: 0.00034, Aligned region: 292..307
ResIII [PF04851], Evalue: 0.00034, Aligned region: 658..721
TIP49 [PF06068], Evalue: 0.00057, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.00057, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.00057, Aligned region: 687..722
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 223..245
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 288..313
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 401..485
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 687..821
NACHT [PF05729], Evalue: 0.0015, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0015, Aligned region: 687..708
Torsin [PF06309], Evalue: 0.0047, Aligned region: 645..713
AAA_14 [PF13173], Evalue: 0.0064, Aligned region: 278..328
AAA_14 [PF13173], Evalue: 0.0064, Aligned region: 686..769
AAA_18 [PF13238], Evalue: 0.0067, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0067, Aligned region: 688..729
Protein Sequence: 1015 a.a.     [Download]
>gi|526459217|ref|YP_008328591.1| type VI secretion ATPase, ClpV1 family [Burkholderia pseudomallei MSHR305]
MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRACGADAARLRRQ
ADAALDARPAGDGGRPAFAPSLLALLQDAWLIASLELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSL
RKDALVARFASGACARSIESRASGALDAAPDEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSEYKKYFEKDAA
LARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRDELAERCAPDTPRVADIDRELAALSARAGALRDAWAAQ
RDAAQALVDARRACRAAADATDAAGTTGTAHAGELADSADVSDVAKMADAADAAPADAETGSNARDADAR
MPAGTCARIAPNPDARARPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIADVVADWT
GIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFLLAGPSGTGKTET
ALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEKAHP
DVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNLGADIIADIAARGARPDPDTMRAAVRPALSRHFKP
ALLARMTEIPYAPLAPDTLADIARLKLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGARNVDFIL
QRHVLPALAQHVLVCAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDAWDRSEASDASDASDASDAIDAVD
AVDAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 3048 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1657118-1660165 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGAACGCGCTCGAAAGCG
CCGTCGGCGCGTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
TGAGCCGTCGGCCGACGTCGCGCTGTTGCTGCGCGCGTGCGGCGCGGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCCGCGCTCGACGCGCGCCCGGCGGGCGACGGCGGCCGCCCCGCGTTCGCGCCGTCGCTGCTCG
CGCTGTTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGACACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCCCGCGCGGCGCGGCAGCCGTCGCCCGGCGGCGACGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCGTGCGCGCGATCGATCGAATCGCGCGCGTCCG
GCGCGCTCGACGCCGCGCCGGACGAGGCGAGCGACACGCGCGACGCATCGAGCGCGATCGCCCGCTACTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCGGGATCGATCCGGTCTTCGGTCGCGACGCGGAAATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTGGGCA
AGACGGCCGTCGTCGAAGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTGCCGGCGACGCTGCGCGGCGC
GACGCTGCTCGGCCTCGACCTCGGCATGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATTCGCGCGTCGCAAACGCCCGTCGTGCTGTTCATCGACGAAGCGCACA
CGCTGATCGGCGCGGGCGGCGCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCGGCCACCACGTGGAGCGAATACAAGAAGTATTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGGACGTCGCGACGTCGGTGATGATCCTGCGCG
GGCTGAAGGAGCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTGGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGCCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACCGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACCAAGCCCGCCGCGCTGGAGGACGCGCAGCGCGCGATCCAGGCGC
TCGAGCGCGAGCGGCGCGCGCTGCGCGACGAATTGGCCGAGCGCTGCGCGCCGGATACGCCGCGCGTCGC
CGACATCGATCGCGAGCTCGCCGCGCTGTCCGCGCGCGCCGGCGCGCTGCGCGACGCGTGGGCGGCGCAG
CGCGACGCCGCGCAGGCGCTCGTCGACGCACGCCGCGCGTGCCGGGCGGCGGCGGATGCAACGGATGCGG
CTGGAACGACCGGAACGGCCCATGCCGGCGAGCTCGCCGATAGTGCCGACGTTTCCGATGTCGCCAAGAT
GGCCGATGCGGCCGACGCCGCCCCTGCCGATGCCGAAACCGGCTCGAACGCCCGCGACGCCGACGCACGC
ATGCCCGCCGGGACGTGCGCGCGCATCGCCCCGAACCCGGATGCGCGGGCGCGGCCCCCTCTGCGCGCGC
CGCACGCCGACGCGCGCGAGCGCGCGGCTCGTGCGCTCGCCGAAGCGACGCGCCGCTTCGAGCACGCGCA
GCGCGACACGCCGCTCGTGCGAATCGACGTCGATCCGGACGCGATCGCCGACGTCGTGGCCGACTGGACC
GGCATCGCGGCCGGCAAGCTGCGCCGCGATCGCGCGAACGTGATGCTGCGGCTCGCCGATACGCTGCGCC
GCCGCATCCGCGGCCAGGATCACGCGATCGAACAGATCTCCGAAGCCGTGAAGGCGGGCGCGGCCGGCGT
CCACGATCCGCGCCGCCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCACCGGCAAGACCGAGACC
GCGCTCGCGGTCGCCGATGCGCTGTTCGGCGACGAGCGCTCGATCGTCGTCGTCAACATGAGCGAATTCC
AGGAGCGGCACGACGTGAGCCGCCTGATCGGCTCGCCGCCGGGCTACGTCGGCTACGGCGAGGGCGGGAT
GCTGACCGAGGCGGTGCGCCAGCGGCCCTATTCGGTCGTGCTGCTAGACGAAGTCGAGAAGGCGCACCCC
GACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGTTCGCTGTCCGACGGCGAAGGCAAGGAGGTCG
ACTTCGCGAACACGGTGATCTTCCTCACGTCGAATCTCGGCGCGGACATCATCGCCGACATCGCCGCACG
CGGCGCGCGGCCCGATCCGGACACGATGCGCGCGGCGGTGCGCCCGGCGCTGTCGCGCCATTTCAAGCCG
GCGCTGCTCGCGCGGATGACCGAGATTCCGTATGCGCCGCTCGCGCCCGATACGCTCGCCGACATCGCGC
GGCTGAAGCTCGAGCGCATCGCGGCGCGCGTCGCCGCGCAGCACGCGACACGCATCGTCTACGACGACGC
CGTCGTCGCGCACGTCGCCGCGCGCTGCACCGAAGTCGAATCGGGCGCGCGCAACGTCGATTTCATCCTG
CAGCGCCACGTGCTGCCCGCGCTCGCGCAGCACGTGCTCGTGTGCGCGGGCAACGCGGCGCCGATGCCTG
CGATTCGCGTCGCCATCGACGCCGGCGGCCGCTTCGTCGTCTCGAACGACGCGCCGGCCGACTCCGATGC
ATGGGACCGGAGCGAAGCGTCCGATGCGTCCGATGCGTCCGATGCGTCCGATGCGATCGATGCGGTCGAT
GCGGTCGATGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCA
ACGCACCCAACGCACCCAACGCACCCAACGCACGCTGA