SecReT6
Protein ID: 526469934
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2311
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2689194..2690132 [-]
ProductompA family protein
NoteTagL
UniProt IDS5NRA3
KEGG IDbpse:BDL_2311
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.10E-25, Aligned region: 146..179
OmpA [PF00691], Evalue: 3.10E-25, Aligned region: 210..304
BON [PF04972], Evalue: 0.0032, Aligned region: 83..121
BON [PF04972], Evalue: 0.0032, Aligned region: 158..171
Protein Sequence: 312 a.a.     [Download]
>gi|526469934|ref|YP_008342450.1| ompA family protein [Burkholderia pseudomallei MSHR305]
MTKPRLPLLRACRFALALALAALALGGAARADNVGPAAVTPIDAGGVPVKSVPLAAPVTAAPVAATAGAG
ATVSPPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGNVATPPNWSANVQKLIGPQ
LKQISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEF
ETGSATLTPQGRAILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQL
TTTGVGPDQPIAPNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 939 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2690132-2689194 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGACGAAGCCCCGCCTGCCCCTGCTGCGCGCCTGCCGCTTCGCGCTCGCGCTCGCGCTCGCCGCGCTCG
CGCTCGGCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCGCCGTCACGCCGATCGACGCAGGCGGCGT
GCCCGTGAAATCGGTGCCGCTCGCCGCGCCCGTGACGGCCGCGCCGGTCGCCGCGACGGCCGGCGCGGGC
GCGACCGTGTCGCCGCCGCCGCCCGCGAACGCGACGCCGGGCCAGGTCGTCGCCGGCGGCAAGGTTGCCG
ACGAAGCGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCA
GATCGAAATCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAA
CTGAAACAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGCGAAGTGCACA
ACGAGGCGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACGCGCTGAATCCGACCTACACGATCAAGAA
CGGGCTGCGCGTGAGCGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAATTC
GAAACCGGCAGCGCGACGCTCACGCCGCAAGGCCGCGCGATTCTCGACCAGATGGCGGGCGCGCTCGCGA
AGATGTCGAGCCGAACGGTCGAGATCATCGGGCACACCGACAACTCGGGCAACCGCACGTCGAACATCGC
GCTCAGCCAGGCGCGCGCGGATGCGGTCAAGGGATATCTGGTGACGAAGGGCATCGCGTCGCAGCAACTG
ACGACGACGGGCGTCGGCCCCGATCAGCCGATCGCGCCGAACGATTCGGCCGACGGGCGCGCACGCAATC
GCCGGATCGAATTCCGCGCGGGACAGTAA