SecReT6
Protein ID: 526470477
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2306
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2681589..2682071 [+]
Productlysozyme family protein
NoteTssE
UniProt IDS5PBA3
KEGG IDbpse:BDL_2306
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-22, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|526470477|ref|YP_008342445.1| lysozyme family protein [Burkholderia pseudomallei MSHR305]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|526469930|ref|NC_021884.1|:2681589-2682071 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGAAACGTTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCACGTGCCGGCGCCCGCCG
CGATGCGGCAGTTGTCGCTGGAGGAGCTGAAGAACACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAAGATCTCGCCGAGCTGCCCGAATGCCAGCGCTCGGTGCTGACCTACGGG
CTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACGATCGCACGTTCATCTGCAAATCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCAGGTGGCGTTCGAGCTGAACGAGCAGTCGAC
GAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCCGCCGAGGAACCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGCGTTCGCGCGCCGCCAAGGTGTGA