SecReT6
Protein ID: 526470737
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2304
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2679465..2680955 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5PC13
KEGG IDbpse:BDL_2304
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|526470737|ref|YP_008342443.1| hypothetical protein BDL_2304 [Burkholderia pseudomallei MSHR305]
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQMSHVAAAAHAPFIASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|526469930|ref|NC_021884.1|:2679465-2680955 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCCACCGGCGTTCAAGCCGGCACGGAATCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCCGAATCCGAGCATGCGCGCGCGAAGGATCTGATCGGCGA
GCTCGTCAGTCAGGTGCTTGACGGCACGGTGGTGGTGTCGGACAACCTGTCGGCGACCATCGACGCGCGC
GTCGCGGAGCTCGATCGCCTGATCTCGTCGCAGCTCTCGGCCGTGATGCACGCGGCGGAGTTCCAGCGTC
TCGAGAGCACCTGGCGCGGGCTCGATTACCTGGTGAAGGAAAGCAACACCGGCTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGAACGCGACCGAGTTCGATCAGAGCGCG
CTCTTCAAGAAGGTGTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ACTACGAGATTTCGCGCCAGCCGGAAGACCAGTACTTCATCGAGCAGATGTCGCACGTCGCGGCCGCCGC
GCACGCGCCGTTCATCGCGTCGGCGGCGCCCGAGCTGCTCGGGCTCGAATCGTTCGCGGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGATACCGTTGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCGC
GATCGCGGAGAGTTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGTCGTGGGCGTTCGCCGCGCGCCTGACGGCGGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACCGAGATCGCGATCACCGATCGCCGCGAGAAGGAACTGAGCGATCTCGGTTTCATC
CCGCTCGTGCACTGCAAGAATTCCGATTACGCCGCGTTCTTTGCCGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCCAACGCGAACGCCGTCCTGTCCGCTCAGCTGCAGTACATCTTCTCGGTATC
GCGCATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCCGCGCAGAACGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGTTGCTCGACGACGACGCGACGCAGGAACAGAAGG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTTTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA