SecReT6
Protein ID: 526471466
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2299
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2674996..2675781 [-]
Producttype IV/VI secretion system , DotU family domain protein
NoteTssL
UniProt IDS5NMZ8
KEGG IDbpse:BDL_2299
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|526471466|ref|YP_008342438.1| type IV/VI secretion system , DotU family domain protein [Burkholderia pseudomallei MSHR305]
MSYAPSLFGGNTPPPAPQTASSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGTRIQEFLSEFE
RGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKDSTVRALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2675781-2674996 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGAGTTACGCGCCCTCCCTCTTCGGCGGCAACACGCCGCCCCCCGCGCCGCAAACGGCTTCGTCGACCG
ACGCCGGCTTCCAGGCGCGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAATTCCTGAGCGAGTTCGAA
CGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTATGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTGCTGTCGTCGCCGTTCAAGATCCGCGCGGACTGGGAGCGCCGGCCGTTGCAGCTCGT
GCTGTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGCGCGCAGGGCGCG
GCGCGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAAAAGCTCGCGTATCTGACCGCACGGCTTGGCGACGAGATCGCGAACATGAAGGGCAAGCG
CGCACCGTTCGCGCCGCATTGGCCGCTGCCGGACCAGATCTCGCACCGGCTCAAGCGCGAGGTGCCGCTG
TGGGCGATCGGAGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGCTGAATACGTATTTGAAAG
ACAGCACCGTGCGGGCGCTCGCGCCTTATTCGCAAGTCATCAAGGTGGGGCCGGAGTCGGCTAATTTGAC
GATTTCGTTGCCTTGA