SecReT6
Protein ID: 526472159
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2300
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2675778..2677124 [-]
Producthypothetical protein
NoteTssK
UniProt IDS5NXQ1
KEGG IDbpse:BDL_2300
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|526472159|ref|YP_008342439.1| hypothetical protein BDL_2300 [Burkholderia pseudomallei MSHR305]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVLRASELSLVFP
DGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRDAGFVSRFVSEQASVADHFTD
AAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDGFVPPCLAIEASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYVLADLPAYRHDDPGPGFARLDSILRELLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2677124-2675778 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGAGTTATTCGGCCAAGGTGCTCTGGGGAGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGG
ACGCGTATCACGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTC
GGTGCGGTTCGATCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTTCCG
GACGGCGCGCTCTACTCCGCGCCGCAAGCCGACGAACTGCCGCCGCCCATCGCGCTCGACACGCTGCCCG
AAGGCATCAACGAATTCACGTTCTACCTCGCGCTGCACCCGCTGCGCGAGACCGGCTCGAACTACGCGGA
CGACCGCGACGCCGGCTTCGTGTCGCGCTTCGTCAGCGAACAGGCGAGCGTTGCCGATCACTTCACCGAC
GCCGCGGAAGCGGACATCACGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGTTGCTGTCGATCCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACGGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCATCAGCGCCTGCGCCAGTTGATCGACGCG
CTGCAGGCGAAGGTGAATGCACTGTACGGTTTCCATCGCGAGCCGACGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCA
CCAGCATTCGGCCTTGCATCCGGAGCGGCTGTTCCAGGAACTACTGCGCCTCGCGGGCCAGTTGATGACG
TTCTCGAAGGGCTACGTGCTCGCCGATCTGCCCGCGTACCGGCATGACGATCCGGGCCCGGGCTTCGCGC
GGCTCGATTCGATCCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCATGTCGGGCGGCTCGACTCGGGCAAGATCGACGACAAGACCGCGTTCTAT
CTCGCGGTGTCGGCCGACATGCCGTCGGTCGAACTCGTCGATGCGGTGCCCGCGCGCTTCAAGGTGGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTCTCCGCGATGCCGGGCGTGCGCCTCGCGTACACGCCGCAGGT
GCCGCCCGCGATTCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAG
CGGATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGA
TCGCCGTCACGTCATGA