SecReT6
Protein ID: 526472464
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2310
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2687846..2688967 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5NYI4
KEGG IDbpse:BDL_2310
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|526472464|ref|YP_008342449.1| hypothetical protein BDL_2310 [Burkholderia pseudomallei MSHR305]
MPTNLTELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVVEQASALLRER
TKDLRLAVWLTEALAIEDGIGGLTQGYTLLTSLCRQFWDHVHPLPDGDDAEYRLGNVAWLAGRTVELLRA
VPLTDGAANAFSELDWDVAQHVAQAIRRDPEQASEIARGKPSVEQIEASKRMTPVAFYARLLGELKAFQA
ALDALEQELDGRAGDAAPSFRQARDAYETVYRLAERFAKEQGYSADAQPQAVAPPAPSERAEPSFKTPLH
SEEPVPRHAHAPCAPAPIVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLAS
VVKDDGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|526469930|ref|NC_021884.1|:2687846-2688967 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGCCGACCAACCTCACCGAACTGCTGACGCCGATCAGCGAAGCGTCGCCGTGCGGCGACGATCTCCTGT
TCTCCGCCGAATTCGACGCGATCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAATG
GATCACCGATATCAAGGAAGCGGACTGGGGCTTCGTCGTCGAGCAAGCGAGCGCGCTGTTGCGCGAGCGC
ACGAAGGATCTGCGGCTCGCGGTATGGCTGACCGAGGCGCTCGCGATCGAGGACGGCATCGGTGGGCTCA
CGCAGGGCTACACGCTGCTCACGAGCCTCTGCCGGCAGTTCTGGGACCACGTGCATCCGCTGCCCGACGG
CGACGACGCCGAATACCGGCTCGGCAACGTCGCGTGGCTCGCCGGGCGCACGGTCGAGCTGCTGCGCGCG
GTGCCGCTCACCGACGGCGCGGCGAATGCGTTCAGCGAGCTCGACTGGGACGTCGCGCAACACGTCGCGC
AGGCGATCCGGCGCGATCCCGAACAGGCGAGCGAGATCGCGCGCGGCAAGCCGTCCGTCGAGCAGATCGA
GGCGTCGAAGCGGATGACGCCCGTGGCGTTCTACGCGCGGCTGCTCGGCGAGCTGAAAGCGTTCCAGGCG
GCGCTCGACGCGCTCGAGCAGGAACTCGACGGGCGGGCGGGCGACGCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTACGAAACCGTCTACCGGCTCGCCGAACGCTTCGCGAAGGAGCAGGGCTACTCGGCCGACGC
GCAGCCGCAGGCCGTCGCGCCGCCCGCGCCGAGCGAGCGCGCGGAGCCGAGCTTCAAGACGCCGCTTCAT
TCGGAGGAACCCGTGCCGAGACACGCACACGCGCCGTGCGCGCCCGCGCCGATCGTGATCGCCGGCATTC
AGAATCGCGCGCAGGCCGTCGAGCAACTGCGCGCGGTCGCGAAATATTTCCGCGGAACCGAGCCGCACAG
CCCCGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCGGACATGCCGCTGCATCAATGGCTTGCGTCG
GTCGTCAAGGACGACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACGATAACGCGT
GA