SecReT6
Protein ID: 526473160
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2303
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2678930..2679448 [+]
Producthypothetical protein
NoteTssB
UniProt IDS5PCR2
KEGG IDbpse:BDL_2303
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|526473160|ref|YP_008342442.1| hypothetical protein BDL_2303 [Burkholderia pseudomallei MSHR305]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|526469930|ref|NC_021884.1|:2678930-2679448 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAGTTGACGTACG
AGGTCGAACGGGGCGATGCGATCGAGATCAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGGCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GATGACGTGATGAAGGCGATCGAGCCGCGCGCGACGTTCCAGGTGGAGAACCGCCTGAGCGAGGCGGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGATCAACGATTTCAATCCGGACGAAGTCGTCGGGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCGGACCTGCGCAACAAACTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAGCTCGAAGCGCTGAAGAAGAGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA