SecReT6
Protein ID: 526473266
SecReT6 ID834
T6SS typei4b
Gene symbol-
Locus tagBDL_2301
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2677233..2677847 [-]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDS5NTC5
KEGG IDbpse:BDL_2301
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-37, Aligned region: 15..176
Protein Sequence: 204 a.a.     [Download]
>gi|526473266|ref|YP_008342440.1| type VI secretion lipofamily protein [Burkholderia pseudomallei MSHR305]
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAAN
DNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYNATEKVSREAQAFG
VVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG
 
Nucleotide Sequence: 615 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2677847-2677233 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGAATCCGCATGTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCG
CCGTGCCGCTCCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCGTCGGCAAACCCGACGTGCC
CGATTCGCAGAAGCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAAC
GACAACCGTCCGCTCGCGCTCGTCGTGCGCCTCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGC
CGTTCGACAGCTTCACCGATCCGACGAAAGAAAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTACGCGA
AATCACGCTGATTCCGGGGCAGCACTACAACGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGC
GTCGTCGCGCTTTTTCGCGATCCGGCGCTACAACGCTGGAAACTAACTTTCGATCCGGCGAAATCCGAGA
AATCCGGCATAATCATTGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCA
GCAAGGCATGCCGACGCAGCGGCTCGATTTGCTGTCGTCGGTGAACTGCGGGTGA