SecReT6
Protein ID: 528817971
SecReT6 ID835
T6SS typei3
Gene symbol-
Locus tagSN31241_12570
StrainSalmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
Repliconchromosome [GenBank: NC_021902] [Browse all T6SS(s) in this replicon]
Location [Strand]1294327..1295322 [-]
ProductType VI secretion protein
NoteTssG
UniProt IDS5T1P0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-94, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|528817971|ref|YP_008359174.1| Type VI secretion protein [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHD
RFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYC
WEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|528816716|ref|NC_021902.1|:c1295322-1294327 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1, complete genome
ATGACCGGCGCTCTCGACCAGGCGCAGAAAACCCCCTGGCGTTACGGATTCCTGAACCTGATGCGGCGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCAC
TGAACCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACCACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCTGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCGGCCTCCGCCCATCTGGTACGCGAATCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAGTTCGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATTGGTTTTGAATATTGC
TGGGAAATTGAGCTGCAGTTGAAGCCTCATGCCGCACCGCCTGCGGTGATCGGCGGTGCGCAGCGGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA