SecReT6
Protein ID: 528817976
SecReT6 ID835
T6SS typei3
Gene symbol-
Locus tagSN31241_12620
StrainSalmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
Repliconchromosome [GenBank: NC_021902] [Browse all T6SS(s) in this replicon]
Location [Strand]1299790..1302429 [+]
ProductChaperone protein ClpB
NoteTssH
UniProt IDS5T1P4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-40, Aligned region: 235..313
AAA_2 [PF07724], Evalue: 6.10E-40, Aligned region: 609..776
AAA [PF00004], Evalue: 3.00E-19, Aligned region: 236..368
AAA [PF00004], Evalue: 3.00E-19, Aligned region: 381..402
AAA [PF00004], Evalue: 3.00E-19, Aligned region: 615..699
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 236..313
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 5.10E-12, Aligned region: 785..856
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 213..256
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 277..315
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 344..406
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 469..520
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 605..659
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 678..708
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 236..402
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 613..634
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 676..706
Sigma54_activat [PF00158], Evalue: 4.20E-06, Aligned region: 232..252
Sigma54_activat [PF00158], Evalue: 4.20E-06, Aligned region: 614..714
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 220..295
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 614..634
NACHT [PF05729], Evalue: 5.80E-05, Aligned region: 236..263
NACHT [PF05729], Evalue: 5.80E-05, Aligned region: 614..642
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 234..259
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 386..413
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 430..456
AAA_19 [PF13245], Evalue: 8.40E-05, Aligned region: 612..636
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 236..335
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 473..531
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 609..642
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 676..697
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 318..404
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 608..664
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 226..253
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 612..638
AAA_14 [PF13173], Evalue: 0.00074, Aligned region: 236..316
AAA_14 [PF13173], Evalue: 0.00074, Aligned region: 382..403
AAA_14 [PF13173], Evalue: 0.00074, Aligned region: 613..696
AAA_17 [PF13207], Evalue: 0.0035, Aligned region: 237..248
AAA_17 [PF13207], Evalue: 0.0035, Aligned region: 614..650
P33MONOX [PF15302], Evalue: 0.0052, Aligned region: 156..194
P33MONOX [PF15302], Evalue: 0.0052, Aligned region: 452..523
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 189..210
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 237..257
RNA_helicase [PF00910], Evalue: 0.0057, Aligned region: 615..636
AAA_18 [PF13238], Evalue: 0.0066, Aligned region: 236..249
AAA_18 [PF13238], Evalue: 0.0066, Aligned region: 616..639
Arch_ATPase [PF01637], Evalue: 0.0074, Aligned region: 215..251
Arch_ATPase [PF01637], Evalue: 0.0074, Aligned region: 290..318
Arch_ATPase [PF01637], Evalue: 0.0074, Aligned region: 381..409
Arch_ATPase [PF01637], Evalue: 0.0074, Aligned region: 613..627
Protein Sequence: 879 a.a.     [Download]
>gi|528817976|ref|YP_008359179.1| Chaperone protein ClpB [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQLPLSDVEK
ALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLA
TLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESNQAIPNGGQDGKSALAKYCQDMTAQARDGKI
DPVTGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLA
GASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWS
EYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALTARIFSLNNEL
TASESRWQRELELVHTLQELRVAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALA
LAEAIYGGEQNLITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVH
ELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAF
LGRVTVIPYLPLDETSRGVIARLHLDRLVARMGEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPQLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|528816716|ref|NC_021902.1|:1299790-1302429 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1, complete genome
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAAT
CGGCAACGGCATTTTGCAAACTACGATCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAAC
ACAGCAGCCCGATAACGATATTCTCCACGTTCTTCGGCATTACCAGCTCCCTCTTTCTGATGTGGAGAAA
GCGTTACTCCGGCAACTGGATATGCTGCCCGCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCG
ATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCGTTACGGCGATAACAAAATTCGCAGCGGCTG
GTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCAGTATCTGCGCGCCGCTGGCC
ACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAAGCGCAGGAGC
GCCCTTACGACGGCTCCGGCCTGGCATCAGCCATTCCCGGTGAAAGCAATCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGCTGGCGAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATC
GACCCGGTGACGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATA
ATCCACTACTGACTGGTGAGGCGGGCGTCGGAAAGACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGC
GCAGGGGGAAGTGCCGCCCGCGCTGCGGGAAGTACGGCTGCTGGCGCTGGACGTTGGCGCTCTGTTGGCC
GGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAGGGTTACTGGAAGAGGCCGGGCGCTCGCCGC
AGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGCGGCGCATCCGGCACGGGCGA
TGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCACCACCTGGAGC
GAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGGCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAGATCCCCGCAATGGAAATGGTACGTGGTTTGGTGGATACGCTGGAAAAACACCATAACGTACT
GATTCTGGATGAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCG
GATAAGGCCATCAGCCTGCTGGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCA
GCGTACAGTTCCTGCGCCAGCAGCTAAAAGCGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAA
AATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGACGGCGCGAATTTTCTCGCTCAACAATGAACTG
ACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTTGCAGGAACTGCGTGTCGCAG
AGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGCAGGGCGACGC
GCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGGTGGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCCGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTA
CCGGGCAAGACGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCC
ACGCAAACCGGTGGGCGTGTTTATGCTGGCCGGGCCGTCTGGTGTCGGTAAAACCGAAACCGCACTGGCG
CTGGCGGAGGCTATCTACGGCGGTGAGCAGAACCTGATTACCATCAATATGAGCGAGTTCCAGGAGGCTC
ACACCGTTTCCACGCTGAAAGGCGCGCCCCCCGGCTATGTGGGCTATGGCGAGGGTGGTGTGCTGACGGA
AGCGGTGCGTCGCCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAAAAGCGCACCATGACGTCCAT
GAACTCTTCTATCAGGTGTTTGACAAGGGCGGGATGGAGGACGGTGAGGGAACACATGTCGATTTCAAAA
ACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCTTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTACGCAAGCATTTCCCGGCGGCATTT
CTGGGCCGCGTGACGGTGATCCCTTACCTGCCGCTGGACGAAACGTCGCGTGGCGTGATTGCCCGTCTGC
ACCTTGACCGGCTGGTGGCGCGGATGGGTGAACAGCACGGCGTGACGCTGACGTATAGCGAGGAACTGGT
CGCACATATTGTGGCGTGCTGTCCAATGCATGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAG
CACATCCTGCCACAACTGTCGCGCTACTGGTTGCAGGCCATGACGGAAAAAGCCGCGATCAGGCAGATTG
ATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGATCGTTTGCTGA