SecReT6
Protein ID: 528817978
SecReT6 ID835
T6SS typei3
Gene symbol-
Locus tagSN31241_12640
StrainSalmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
Repliconchromosome [GenBank: NC_021902] [Browse all T6SS(s) in this replicon]
Location [Strand]1303095..1304603 [+]
ProductType VI secretion protein, EvpB
NoteTssC
UniProt IDS5T2T0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-191, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|528817978|ref|YP_008359181.1| Type VI secretion protein, EvpB [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
MANSNMQATDAVAQDTVSASGEFDALLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITVSDDAYKSISA
IIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWD
QSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQE
LANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYV
WSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRL
VTKLPSVKQGNA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|528816716|ref|NC_021902.1|:1303095-1304603 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGTCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGCAACAGGCGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCT
ATTATTGCGCAGATCGACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGA
AGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAAT
CCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGAT
CAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTA
TCATTGCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGC
CGCGTCGGCCCATGCGCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAG
CTGGCGAATCCCCGCGACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGC
GGGCTAGCGAAGACTCCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGC
AAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACTAAATACGTC
TGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGT
TGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGG
CGGCGTGGACATGAAATGCCCGACCGAAATTGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAAC
GGTTTTATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAATCGCTGCAAA
AACCACAGGAATACTACGATCCGGACGCGACGGCCAACGCCAACCTGTCCGCCCGTCTGCCGTACCTGTT
CGCCTGCTCGCGCTTCGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGT
GAGGATATGCAGCGCTGGCTAAATGAATGGATTATGAATTACGTCGACGCCGATCCGGTGAACTCCTCGC
AAGAAACTAAAGCCCGTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTGGAAGGCAATCCAGG
TTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTG
GTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA