SecReT6
Protein ID: 528986877
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051291
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5474850..5477543 [-]
ProductVgrG protein
NoteTssI
UniProt IDR4Y0P7
KEGG IDaxo:NH44784_051291
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-80, Aligned region: 42..354
Phage_GPD [PF05954], Evalue: 3.70E-80, Aligned region: 528..623
DUF2345 [PF10106], Evalue: 1.10E-33, Aligned region: 705..866
T6SS_Vgr [PF13296], Evalue: 6.70E-28, Aligned region: 564..668
Phage_base_V [PF04717], Evalue: 2.50E-19, Aligned region: 411..514
Protein Sequence: 897 a.a.     [Download]
>gi|528986877|ref|YP_008032194.1| VgrG protein [Achromobacter xylosoxidans NH44784-1996]
MPQDSSGLSRLSTAGIAQANRLLDLRTPLGENRLVAETLSATEQLSGGAYRLEITALSHDAHIPLKALMG
QPVTLRLQTALDREQPRLWHGHATAVRFLGANGGLARYGLTVEPWLAFLRARRDSFAYQDKTVIDIVDSI
FGDYKGQGALAPQWRWEVKDRAAYAKRSLAIQYRETDYAFVERLLAEEGLFYWVEHADDGHTLVIADHNG
AFKPGPQASVRFARADVTETEDSIQRWSPRQRWQTNAVRMASWDYRSAQARPVSAQADAGKLANAIELVS
DDYPGQYAYEDSAQGERLAHNALAALRVRQQSIEGAGTVRTLAPGQRFELTGHYQQGGASAFVVIAITHQ
ARNNFDADLGRAVSEALGGGDSDDADFYRNAFTCIGSDTEFRPATQDGHGVRLHPRPTVFGAQTALVIGA
EEPVLTDRDHRIKVQFHWQRGKASSSRMAHPSGDENAPAKDELGTWVRVAEPVAGGDWGGHFVPRVGQEV
LVEFLHGDIDRPVVVGALYNGEGAEDASHNKVQAGGANATGNAPAWFAGANEGHAHNAVMSGFKTQALAS
SGAGTGGYNQLVQDDTPGQSRLTASTTQADARLNLGHVKQQRDNERLQDLGHGAELSTKEAVALRGGSGL
LLSADLRENAEGPLLDSAEASKQIEAALEAARELADVAVRQKAILDGDPQALPAQEGLQHILEVVEATQD
DPNPQGAAVKVATYSEPHIQVSAPSGIGQYTPANAFLVAGATFAQIAPDVNWASSAHLAVGVAGGALLFT
AGHAAGGGRPVKDAGLRLHAAGGKLRLHSQDARMTLSAEKAVTFASAGANVLVEGKQRVLATAAGAYLRL
EGGGIQLHAPGKVELKAGAHSWVGPQTASGNLAPPSGEFKDCPSKVNSAAAGGSAFV
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|528981796|ref|NC_021285.1|:c5477543-5474850 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGCCCCAGGATTCTTCCGGACTGTCCCGCCTGTCGACCGCCGGCATCGCGCAGGCCAACCGCCTGCTGG
ACCTGCGCACGCCGCTGGGCGAGAACCGCCTGGTGGCCGAGACCCTGTCGGCCACCGAACAATTGAGCGG
CGGCGCCTATCGCCTGGAGATCACCGCGCTGTCCCACGACGCGCATATCCCGCTGAAGGCCCTGATGGGC
CAACCCGTCACCCTGCGCCTGCAGACCGCGCTGGACCGCGAGCAGCCGCGCCTGTGGCACGGCCACGCCA
CGGCGGTGCGTTTCCTGGGCGCCAATGGCGGCCTGGCGCGCTATGGGCTGACCGTGGAGCCGTGGCTGGC
GTTCCTGCGGGCGCGGCGCGACAGCTTCGCCTACCAGGACAAGACGGTGATCGACATCGTCGACAGCATC
TTCGGCGACTACAAGGGCCAGGGCGCGCTGGCGCCGCAATGGCGCTGGGAAGTGAAGGATCGCGCCGCCT
ACGCCAAGCGCAGCCTGGCCATCCAGTACCGCGAAACCGACTACGCCTTCGTCGAGCGCCTGCTGGCCGA
AGAGGGCCTGTTCTACTGGGTCGAGCACGCCGACGACGGCCATACCCTGGTCATCGCCGACCACAACGGC
GCCTTCAAGCCCGGCCCGCAGGCCAGCGTGCGTTTCGCGCGCGCCGACGTCACCGAAACCGAAGACAGCA
TCCAGCGCTGGAGTCCGCGCCAGCGCTGGCAGACCAACGCCGTGCGCATGGCCAGCTGGGACTACCGCAG
CGCCCAGGCGCGGCCGGTCTCGGCGCAGGCGGACGCCGGCAAGCTGGCCAACGCGATCGAGCTGGTCAGC
GACGACTATCCCGGCCAGTACGCCTACGAGGACAGCGCCCAGGGCGAGCGGCTGGCGCACAATGCGCTGG
CCGCGTTGCGCGTGCGCCAGCAGAGCATCGAAGGCGCGGGCACCGTGCGCACGCTGGCGCCGGGGCAGCG
TTTCGAGCTGACCGGCCACTACCAGCAGGGCGGCGCGTCCGCCTTCGTGGTGATCGCCATCACGCACCAG
GCCCGCAACAACTTCGACGCCGACCTGGGCCGCGCCGTGAGCGAGGCGTTGGGGGGCGGCGACAGTGACG
ACGCCGATTTCTATCGCAACGCCTTCACCTGCATCGGCAGCGACACCGAATTCCGTCCCGCGACGCAGGA
TGGCCATGGCGTGCGCCTGCACCCCCGTCCCACCGTGTTCGGCGCGCAGACCGCCCTGGTGATCGGCGCC
GAGGAACCGGTGCTCACCGACCGCGACCACCGCATCAAGGTGCAGTTCCATTGGCAGCGCGGCAAGGCCT
CCAGCAGCCGGATGGCGCATCCTTCGGGGGACGAGAACGCGCCCGCCAAGGATGAACTGGGCACCTGGGT
GCGCGTGGCCGAGCCCGTCGCCGGCGGCGACTGGGGCGGCCATTTCGTGCCGCGCGTGGGCCAGGAGGTG
CTGGTGGAATTCCTGCATGGCGACATCGACCGGCCGGTGGTGGTCGGCGCGCTCTACAACGGCGAGGGCG
CCGAGGATGCCTCGCACAACAAGGTGCAGGCGGGCGGCGCCAACGCCACCGGCAATGCGCCGGCCTGGTT
CGCCGGCGCCAACGAGGGCCACGCCCACAACGCGGTGATGTCCGGCTTCAAGACCCAGGCCCTGGCCAGC
AGCGGCGCCGGCACCGGCGGCTACAACCAGCTGGTGCAGGACGACACGCCGGGCCAGTCGCGCCTGACCG
CCTCGACCACCCAGGCCGATGCGCGCCTGAACCTGGGCCACGTCAAGCAGCAGCGCGACAACGAGCGGCT
GCAGGACCTGGGCCATGGCGCCGAGCTGTCGACCAAGGAGGCGGTGGCGCTGCGCGGCGGCTCGGGGCTG
CTGCTGAGCGCCGACCTGCGCGAGAACGCCGAAGGGCCGCTGCTCGACAGCGCCGAGGCATCCAAGCAGA
TCGAGGCCGCGCTGGAAGCGGCCAGGGAACTGGCCGACGTCGCGGTCAGGCAGAAGGCCATCCTGGATGG
CGACCCGCAAGCGCTGCCGGCGCAAGAGGGCCTGCAACACATCCTGGAAGTGGTCGAGGCCACCCAGGAC
GATCCCAATCCCCAGGGCGCCGCCGTCAAGGTGGCGACCTACAGCGAACCGCACATCCAGGTCAGCGCGC
CCAGCGGCATCGGCCAGTACACGCCGGCCAATGCCTTCCTGGTGGCCGGCGCCACCTTCGCGCAGATCGC
GCCGGACGTGAACTGGGCCAGCAGCGCGCACCTGGCGGTGGGCGTGGCGGGCGGCGCCTTGCTGTTCACG
GCCGGCCACGCCGCCGGCGGCGGCCGGCCGGTCAAGGACGCGGGCCTGCGCCTGCATGCGGCCGGGGGCA
AGCTGCGCCTGCACAGCCAGGACGCCAGGATGACCCTGAGCGCCGAAAAAGCCGTGACCTTCGCCTCCGC
CGGCGCCAACGTGCTGGTCGAGGGCAAGCAGCGCGTGCTGGCCACGGCCGCCGGCGCCTATCTGCGGCTG
GAGGGCGGCGGCATCCAGCTGCATGCGCCGGGCAAGGTCGAGTTGAAGGCCGGCGCGCACAGCTGGGTCG
GGCCGCAGACGGCCAGCGGCAACCTGGCCCCGCCCTCGGGTGAATTCAAGGATTGCCCGAGCAAGGTCAA
CAGCGCCGCGGCGGGAGGGTCGGCCTTTGTTTGA