SecReT6
Protein ID: 528986878
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051301
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5477560..5480244 [-]
ProductClpB protein
NoteTssH
UniProt IDR4Y270
KEGG IDaxo:NH44784_051301
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.70E-44, Aligned region: 229..273
AAA_2 [PF07724], Evalue: 5.70E-44, Aligned region: 623..792
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 229..342
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 629..747
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 229..249
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 628..747
ClpB_D2-small [PF10431], Evalue: 6.30E-12, Aligned region: 574..574
ClpB_D2-small [PF10431], Evalue: 6.30E-12, Aligned region: 799..873
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 206..246
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 273..307
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 467..531
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 597..664
AAA_16 [PF13191], Evalue: 3.80E-10, Aligned region: 694..717
AAA_22 [PF13401], Evalue: 9.90E-08, Aligned region: 228..315
AAA_22 [PF13401], Evalue: 9.90E-08, Aligned region: 353..413
AAA_22 [PF13401], Evalue: 9.90E-08, Aligned region: 625..649
AAA_22 [PF13401], Evalue: 9.90E-08, Aligned region: 689..722
Clp_N [PF02861], Evalue: 7.20E-07, Aligned region: 23..74
Clp_N [PF02861], Evalue: 7.20E-07, Aligned region: 113..125
AAA_29 [PF13555], Evalue: 1.40E-06, Aligned region: 223..246
AAA_29 [PF13555], Evalue: 1.40E-06, Aligned region: 623..653
AAA_29 [PF13555], Evalue: 1.40E-06, Aligned region: 726..756
AAA_29 [PF13555], Evalue: 1.40E-06, Aligned region: 768..783
Sigma54_activat [PF00158], Evalue: 4.90E-05, Aligned region: 207..243
Sigma54_activat [PF00158], Evalue: 4.90E-05, Aligned region: 626..745
AAA_17 [PF13207], Evalue: 5.60E-05, Aligned region: 65..106
AAA_17 [PF13207], Evalue: 5.60E-05, Aligned region: 229..273
AAA_17 [PF13207], Evalue: 5.60E-05, Aligned region: 628..665
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 229..251
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 625..650
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 208..242
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 281..366
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 625..667
IstB_IS21 [PF01695], Evalue: 0.00028, Aligned region: 222..251
IstB_IS21 [PF01695], Evalue: 0.00028, Aligned region: 628..646
AAA_23 [PF13476], Evalue: 0.0018, Aligned region: 229..245
AAA_23 [PF13476], Evalue: 0.0018, Aligned region: 468..510
AAA_23 [PF13476], Evalue: 0.0018, Aligned region: 625..659
NACHT [PF05729], Evalue: 0.0034, Aligned region: 229..256
NACHT [PF05729], Evalue: 0.0034, Aligned region: 629..648
MobB [PF03205], Evalue: 0.0058, Aligned region: 230..257
MobB [PF03205], Evalue: 0.0058, Aligned region: 627..660
MobB [PF03205], Evalue: 0.0058, Aligned region: 744..762
Protein Sequence: 894 a.a.     [Download]
>gi|528986878|ref|YP_008032195.1| ClpB protein [Achromobacter xylosoxidans NH44784-1996]
MATPLKTLIGKLNQTCRQAAERAASLCMAQGHYEVDLEHLFLALLEKPASDFSIVARRSGIEASVLEADL
NAEIRGFKNGNTRTPVFSPHLPRLFEHAWLIASLDTQTTRIRSGHLLLALLTEPDLAALARRGSRLFESF
RLEELKHDFAALTAGSEEAGQSVALGDDAAQGEAASPAAALSKTPALDQYTTNLTERAREGKIDPVIGRD
AEIRQMIDILTRRRQNNPILTGEAGVGKTAVVEGLALRIVAGDVPPALAGVALRTLDMGLLQAGASVKGE
FENRLKSVIDEVKQSPTPIILFIDEAHTMIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFE
KDAALARRFQVVKVEEPSETLAASMLRGMAPLMEQHFGVRILDEAIVAAARLSHRYISGRQLPDKAVGVL
DTACARVALGRSATPALIDDARHRLARQETERAALRREAAAGAAQSARLRELDEEMAATRQQLVDAEARL
AQESELVRQIHALREELEAAGQEPESETTGKRRGGKAAEPTPAQAQLAELQQQLRALQGEAPLVPAYVDA
QVIAEIVSAWTGIPLGRMVNDEIRTVLELQPLLAERVIGQDHALHAIAQRVRTARAGLEDPNKPKGVFLF
VGPSGVGKTETALAVADILYGGERKLVTINMSEYQEAHSVAGLKGSPPGYVGYGEGGVLTEAVRRQPYSV
VLLDEIEKAHPDVLELFFQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSTIMQACLNKTAEERPDPDAL
QELLAPQLYKAFKPAFLGRMKTIAYYPVDDDALARIIGLKLARIAERVQANHRAVFDWDDALVEAVLARC
TEVDTGARNVDHILNGTLLPQIAEQVLGRMAQGEAIARIRVTAGKNGDFRYRLT
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|528981796|ref|NC_021285.1|:c5480244-5477560 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGGCCACTCCCCTGAAAACCCTGATCGGGAAACTGAACCAGACCTGCCGCCAGGCCGCCGAGCGCGCCG
CCAGCCTGTGCATGGCGCAAGGCCACTACGAGGTGGACCTGGAGCACCTGTTCCTGGCGCTGCTGGAAAA
GCCCGCCAGCGATTTCAGCATCGTGGCGCGCCGCAGCGGCATCGAGGCCTCGGTGCTGGAGGCCGACCTG
AACGCCGAGATCCGCGGCTTCAAGAACGGCAATACCCGCACCCCGGTGTTTTCGCCGCATCTGCCGCGCC
TGTTCGAGCATGCCTGGCTGATCGCCTCGCTGGACACGCAGACCACCCGCATCCGTTCCGGCCACCTGTT
GCTGGCGCTGCTGACCGAGCCCGATCTGGCGGCGCTGGCGCGGCGCGGCTCGCGCCTGTTCGAGTCGTTC
CGGCTGGAAGAGCTGAAGCACGACTTCGCGGCCCTGACGGCCGGCTCGGAAGAGGCCGGCCAGTCCGTCG
CATTGGGCGATGACGCCGCGCAGGGCGAGGCCGCATCACCCGCGGCCGCGCTGTCCAAGACGCCGGCGCT
GGACCAATACACCACCAACCTGACCGAGCGCGCCCGCGAAGGCAAGATCGATCCGGTGATCGGCCGCGAT
GCCGAGATCCGGCAGATGATCGACATCCTGACGCGGCGTCGCCAGAACAATCCCATCCTGACCGGCGAGG
CCGGCGTCGGCAAGACCGCGGTGGTCGAAGGCCTGGCGCTGCGCATCGTGGCCGGCGACGTGCCGCCGGC
GCTGGCCGGCGTGGCGCTGCGCACGCTGGACATGGGCCTTTTGCAGGCCGGCGCCAGCGTCAAGGGCGAG
TTCGAGAACCGCCTGAAAAGCGTGATCGACGAGGTCAAGCAAAGCCCCACGCCCATCATCCTGTTCATCG
ACGAGGCCCATACCATGATCGGCGCGGGCGGGCAGGCCGGCCAGAACGATGCGGCCAACCTGCTCAAGCC
GGCGCTGGCGCGCGGCGAACTGCGCACCATCGCCGCCACCACCTGGAGCGAATACAAGAAGTACTTCGAG
AAGGACGCCGCGCTGGCGCGGCGCTTCCAGGTGGTCAAGGTGGAAGAACCCAGCGAGACGCTTGCCGCCA
GCATGCTGCGCGGCATGGCGCCGCTGATGGAACAGCATTTCGGCGTGCGCATCCTGGACGAAGCGATTGT
GGCCGCCGCCCGCCTGTCGCACCGCTACATCAGCGGCCGCCAATTGCCGGACAAGGCGGTCGGTGTGCTG
GACACCGCCTGCGCCCGGGTGGCATTGGGCCGTAGCGCCACGCCGGCCCTGATCGACGACGCCCGCCACC
GCCTGGCGCGCCAGGAAACCGAGCGCGCCGCCCTGCGCCGCGAGGCCGCCGCCGGCGCCGCGCAGTCGGC
CCGCCTGCGCGAGCTGGACGAGGAGATGGCCGCCACCCGCCAGCAACTGGTCGACGCCGAAGCGCGCCTG
GCCCAGGAAAGCGAGCTGGTGCGGCAGATCCACGCGCTGCGCGAGGAGCTGGAAGCCGCGGGCCAGGAGC
CCGAGTCCGAAACCACCGGCAAGCGCCGCGGCGGCAAGGCCGCCGAGCCGACGCCCGCCCAGGCGCAACT
GGCCGAGTTGCAGCAGCAACTGCGCGCCCTGCAGGGCGAGGCGCCGCTGGTGCCGGCCTACGTGGATGCG
CAGGTGATCGCCGAGATCGTCTCGGCCTGGACCGGCATCCCGCTGGGCCGCATGGTCAACGACGAAATCC
GCACCGTGCTGGAACTGCAGCCGCTGCTGGCCGAACGCGTGATCGGCCAGGATCACGCGCTGCACGCCAT
CGCCCAGCGCGTGCGCACCGCGCGCGCCGGCCTGGAAGACCCGAACAAGCCCAAGGGCGTGTTCCTGTTC
GTCGGCCCCTCCGGCGTGGGCAAGACCGAGACCGCGCTGGCGGTGGCCGACATCCTGTACGGCGGCGAGC
GCAAGCTGGTTACGATCAACATGAGCGAATACCAGGAGGCCCACAGCGTCGCGGGCCTGAAGGGCTCGCC
GCCCGGCTACGTCGGCTACGGCGAAGGCGGCGTGCTGACCGAGGCCGTGCGGCGCCAGCCCTACAGCGTG
GTGCTGCTGGACGAGATCGAGAAGGCCCATCCCGACGTGCTGGAGCTGTTCTTCCAGGTGTTCGACAAGG
GCGTGATGGACGATGCCGAAGGGCGCGAGATCGACTTCCGCAACACGCTCATCATCCTGACCTCCAACGT
CGGCTCGTCGACCATCATGCAGGCCTGCCTGAACAAGACCGCCGAGGAACGGCCGGACCCGGACGCTTTG
CAGGAATTGCTGGCGCCGCAGCTGTACAAGGCTTTCAAGCCCGCCTTCCTGGGCCGCATGAAGACCATCG
CCTACTACCCGGTGGATGACGACGCCCTGGCGCGCATCATTGGCCTGAAGCTGGCCCGCATCGCCGAGCG
GGTGCAGGCCAACCACCGCGCCGTGTTCGATTGGGACGACGCGCTGGTCGAGGCCGTGCTGGCGCGCTGC
ACCGAGGTGGACACGGGCGCGCGCAACGTCGACCACATCCTGAACGGCACGCTGCTGCCGCAGATCGCCG
AACAGGTGCTGGGCCGCATGGCGCAGGGCGAGGCGATCGCGCGCATCCGCGTCACGGCCGGCAAGAACGG
CGACTTCCGCTACCGCCTGACCTGA