SecReT6
Protein ID: 528986880
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051321
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5481328..5483166 [-]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDR4XW86
KEGG IDaxo:NH44784_051321
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.20E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|528986880|ref|YP_008032197.1| Protein ImpG/VasA [Achromobacter xylosoxidans NH44784-1996]
MEELLPYYERELGFLRGSSRDFAQRYPKIAARLGLSGETCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALFEVMYPHYLRPFPACSIAQFDMGGVAAQLTAPVRVARGTELKSHAVRGVACRFRTAYDVTLAPVAI
RQATFASTANAPSATQLPPGVTGRLSLTLACLAETQSFATLAVDRLRVYLHGEPSFVAALRDCLFLRTAA
AYIETQPGRWNRLPDVPLAQVGLAEDDALIDFPASSHPAYRLLAEYFVFSEKFNFVDIDLAALRRAVGPL
REFTLHLPVKGLRADSNTARLLESASADNFRLGCTPVINLFEQRADPIRVTHAAASYPVVADARRAYGYE
VYSIDRVRLVRQNAQGDSVVEFRPFYSLHHGETPEGASHYWTARRDAMVAERSPGYEMEMSIVDIDFNPA
LPQTETLSLELTCTNRDLPSHLAVGQPGGDLFLEGGSVAREIRMLRRPTHTHRFQQGRAAHWRLISHLAL
NHLSLVHSGLPALKETLRLYDLSHAAVAARQIEGLVGLDYKPATHWMPGEPFATFVRGIEIRLTINEENF
VGTSLHAFVAVLNRFFGLYVHANSFVQLVVLSRRGAEEILRCPPCNGDAILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|528981796|ref|NC_021285.1|:c5483166-5481328 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGGAAGAACTGCTGCCGTATTACGAACGCGAGCTGGGGTTCCTGCGCGGCTCGTCGCGGGATTTCGCCC
AGCGCTATCCGAAGATCGCCGCGCGCCTGGGGCTGTCGGGAGAGACCTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCCCTGCTGGGCGCGCGCATCAACAAGAAGCTGGACGACGACTATCCGGAATTC
ACGGAAGCGTTGTTCGAAGTGATGTATCCGCATTACCTGCGGCCGTTTCCGGCGTGTTCGATCGCGCAGT
TCGACATGGGCGGGGTGGCGGCCCAACTGACCGCGCCGGTGCGCGTGGCGCGGGGCACCGAATTGAAATC
GCACGCCGTGCGCGGCGTGGCCTGCCGCTTCCGCACGGCCTACGACGTGACGCTGGCGCCGGTGGCCATC
CGCCAGGCCACGTTCGCTTCGACCGCCAACGCGCCATCGGCCACGCAACTGCCGCCGGGCGTGACCGGCC
GCCTGTCGCTGACGCTGGCCTGCCTGGCCGAAACGCAGAGCTTTGCCACCTTGGCCGTGGACCGCCTGCG
GGTCTATCTGCATGGCGAGCCGTCGTTCGTGGCGGCGCTGCGCGACTGCCTGTTCCTGCGCACCGCGGCG
GCCTACATCGAGACCCAACCCGGCCGCTGGAACCGGCTGCCTGACGTGCCGCTGGCCCAGGTGGGACTGG
CCGAGGACGACGCGCTGATCGATTTTCCGGCCAGCTCGCATCCGGCCTACCGGCTGCTGGCCGAGTACTT
CGTCTTTTCCGAAAAATTCAACTTCGTCGACATCGACCTGGCGGCGCTGCGGCGCGCGGTCGGGCCGCTG
CGCGAATTCACGCTGCACCTGCCGGTCAAGGGGCTGCGCGCCGATTCGAATACCGCGCGCCTGCTGGAAT
CGGCCTCGGCCGACAACTTCCGGCTGGGCTGCACGCCGGTGATCAACCTGTTCGAGCAGCGCGCCGATCC
CATCCGCGTCACGCATGCGGCGGCCTCCTATCCGGTGGTGGCCGATGCGCGCCGGGCCTACGGCTACGAG
GTCTATTCCATCGACCGCGTGCGGCTGGTGCGGCAGAACGCGCAGGGCGATTCGGTGGTGGAGTTCCGGC
CGTTCTATTCGCTGCACCACGGCGAGACGCCCGAGGGCGCCAGCCATTACTGGACCGCGCGGCGCGATGC
GATGGTGGCCGAGCGCAGCCCGGGCTACGAAATGGAGATGTCCATCGTCGACATCGACTTCAATCCGGCC
CTGCCGCAGACCGAAACGCTGAGCCTGGAGCTGACCTGCACCAATCGCGACCTGCCGTCGCACCTGGCGG
TGGGCCAGCCGGGCGGCGACCTGTTCCTGGAGGGCGGCTCGGTGGCGCGCGAGATCCGCATGCTGCGCCG
CCCGACCCATACGCACCGCTTCCAGCAGGGCCGCGCGGCGCACTGGCGCCTGATCTCGCACCTGGCGCTG
AACCACCTGTCGCTGGTGCACAGCGGCCTGCCGGCGCTGAAGGAAACCCTGCGCCTGTACGACCTGTCGC
ACGCGGCGGTGGCCGCGCGCCAGATCGAAGGGCTGGTGGGGCTGGACTACAAGCCCGCCACCCACTGGAT
GCCGGGCGAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCAATGAAGAAAACTTC
GTGGGCACCAGCCTGCATGCCTTCGTGGCGGTGCTCAACCGCTTCTTCGGCCTTTACGTGCACGCCAACA
GCTTCGTGCAGTTGGTGGTGCTGTCGCGCCGCGGCGCGGAAGAAATCCTACGGTGTCCCCCATGCAACGG
CGACGCGATCCTAGCGTAA