SecReT6
Protein ID: 528986884
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051361
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5485803..5486327 [-]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDR4XWX4
KEGG IDaxo:NH44784_051361
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-58, Aligned region: 11..166
Protein Sequence: 174 a.a.     [Download]
>gi|528986884|ref|YP_008032201.1| Uncharacterized protein ImpB [Achromobacter xylosoxidans NH44784-1996]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVGDFSAQSEAELPRLKDRKFVNIDVDNF
DDVMRGLEPRAAYRVKNRLTDEGGTFGVDLKFRSIEDFRPEAVVQQIEPLKELLEIRTKLADLRNKLAGN
DKLEDLLGEVLSSTEKLQQLTSEAGKDGKGGSNE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|528981796|ref|NC_021285.1|:c5486327-5485803 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGGCTAAGAAAGAAAGCGTTCAGAAAAGACTCCAGAAAGTACGCCCGCCGCGCGTCCAGTTGACCTATG
ACGTCGAGAAGGGCGACGCGATTGAGCAGAAGGAACTGCCCTTCGTCGTGGGTGTGGTGGGCGACTTCAG
CGCGCAGTCGGAAGCCGAGCTGCCGCGCCTGAAGGACCGCAAGTTCGTCAATATCGACGTCGATAACTTC
GACGACGTGATGCGCGGCCTCGAGCCGCGCGCCGCGTACCGCGTGAAGAACCGCCTGACCGACGAGGGCG
GCACCTTCGGCGTCGACCTGAAGTTCCGCTCGATCGAGGACTTCCGTCCCGAGGCCGTGGTGCAGCAGAT
CGAACCGCTCAAGGAATTGCTGGAGATCCGCACCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGACCTGCTGGGCGAAGTGCTCAGCAGCACGGAAAAACTGCAGCAACTGACCAGCGAAG
CCGGCAAGGACGGCAAGGGAGGCAGCAATGAGTAA