SecReT6
Protein ID: 528986886
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051381
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5487481..5487846 [+]
Producthypothetical protein
NoteTssJ
UniProt IDR4XWR5
KEGG IDaxo:NH44784_051381
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-18, Aligned region: 1..92
Protein Sequence: 121 a.a.     [Download]
>gi|528986886|ref|YP_008032203.1| hypothetical protein NH44784_051381 [Achromobacter xylosoxidans NH44784-1996]
MKNAEAFQRAPLTQLVDTAQEKAALGDSLIASREITLTPGQRFENVEKVPKGAAYIAVAALFYAPAPQRW
KYVFEVKEVEDTGIVLGAHACAMTVATGKIVLPPGMPAFDPSRLGSLQCPN
 
Nucleotide Sequence: 366 bp     [Download]
>gi|528981796|ref|NC_021285.1|:5487481-5487846 Achromobacter xylosoxidans NH44784-1996 complete genome
TTGAAGAATGCCGAGGCATTTCAGCGCGCGCCGCTCACTCAATTGGTTGATACTGCGCAGGAAAAGGCGG
CATTGGGCGACAGTCTCATCGCGTCGCGCGAAATCACCCTGACGCCGGGCCAGCGTTTCGAGAACGTCGA
AAAGGTGCCGAAAGGCGCCGCATATATCGCCGTTGCCGCCTTGTTTTACGCGCCCGCGCCGCAGCGCTGG
AAATACGTGTTCGAGGTCAAGGAAGTCGAAGACACCGGCATCGTGCTGGGCGCGCATGCCTGCGCCATGA
CGGTCGCCACCGGCAAGATCGTGCTGCCGCCAGGCATGCCCGCGTTCGATCCGTCCCGGCTCGGTTCCCT
GCAATGCCCGAACTGA